KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_4427Help
Entry
GYO_4427          CDS       T01635                                 

Definition
(GenBank) firmicute fructose-1,6-bisphosphatase superfamily
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00010  Glycolysis / Gluconeogenesis
bst00030  Pentose phosphate pathway
bst00051  Fructose and mannose metabolism
bst00680  Methane metabolism
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01120  Microbial metabolism in diverse environments
bst01130  Biosynthesis of antibiotics
bst01200  Carbon metabolism
Module
bst_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_4427
   00030 Pentose phosphate pathway
    GYO_4427
   00051 Fructose and mannose metabolism
    GYO_4427
  Energy metabolism
   00680 Methane metabolism
    GYO_4427
Enzymes [BR:bst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     GYO_4427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AEP88984
UniProt: G4NZ21
Position
4120950..4122875
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKPALNEWYKETINRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKAAENRPEAEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLHGKTYQLENTCFATVNP
EQPDQLLEEEAEVIDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIEDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacttagatctactcgcacaaaaatacgattgtgaagaaaaagtagta
acagaaatcattaatttgaaagcgatactgaacctgccaaagggaactgagcattttgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcgtaatggttcaggacga
gtcaaagagaagatacgcgacatcttcagcggtgtcatttacgatagagaaatcgatgaa
ttagcagcattggtctattatccggaagacaaactgaagttaatcaaacatgactttgat
gcgaaaccagcattaaacgagtggtataaagaaacgattaatcgaatgattaagctcgtt
tcatattgctcctccaagtatacccgctccaaattacgcaaagcactgcctgcccagttt
gcttatattacggaggagctgctatataaaacagaacaagctggcaacaaggagcaatat
tactccgaaatcattgatcagatcattgaacttggccaagctgataagctgatcaccggc
cttgcttacagcgttcagcgactggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccacagccggacaggattatggaggagctgatcaactaccattcagtcgat
attcaatggggaaatcacgatgtcctttggatcggcgcctattccggttccaaagtgtgc
ctggccaatattatccgtatctgtgcccgctacgataaccttgatattattgaagacgtg
tacggcatcaacctgagaccgctgctgaacctggccgaaaaatattatgacgataatcca
gcatttcgcccaaaagcagccgaaaatagaccagaagcagagattaagcaaatcacaaaa
atccatcaagcgattgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaacatggaggaacggctgttactagagaagattgattatgataaaaatgaa
atcacgctgcatggaaaaacatatcagctggaaaacacctgctttgcgacagtgaatccg
gaacagccagatcagctattagaagaagaagcagaagtcatagacaagctgctattctct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttgattcacggctgtattcctgtcgacgaaaacggc
aatatggaaacgatgatgattgaggataaaccgtatgcgggccgtgagctactcgatgta
tttgaacggttcttaagagaagcgtttgcccatccggaagaaaccgatgacctggcgaca
gatatggcttggtatttatggacaggcgagtactcctccctcttcggaaaacgcgccatg
acaacatttgagcggtatttcatcaaagagaaggaaacgcataaagagaagaaaaacccg
tattattatttacgcgaagacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcatcaacggccatacacccgtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctat
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgacgtctta
acggtgaaacgattagtggacaaagagcttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggagttgttgcaggaagttgcgattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system