KEGG   Burkholderia stagnalis: WT74_05255Help
Entry
WT74_05255        CDS       T04885                                 

Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00540  Lipopolysaccharide biosynthesis
bstg01100  Metabolic pathways
Module
bstg_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    WT74_05255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bstg01005]
    WT74_05255
Enzymes [BR:bstg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     WT74_05255
Lipopolysaccharide biosynthesis proteins [BR:bstg01005]
 Unusual sugar
  WT74_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AOK52169
Position
1:1163782..1164774
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANIVKALNERGETRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFAER
FARGDFGKVRAVFHEGACSDTMEHDGRYMMDNNFRYSRGVLDACLAQGAQFLYASSAATY
GGSTRFVEEREVEAPLNIYGYSKFLFDQVIRRVLPSAKSQIAGFRYFNVYGPRETHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYAPGEQTRDFVSVEDVVKVNLFFFDHPEKSGIFNL
GTGRAQPFNDVATSVVNTLRALDSLPPLTLAQQVEQGLIEYVPFPDALRGKYQCFTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLSGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgtcaccggcgcggccggtttcatcggcgcgaacatcgtcaaggcgctc
aacgagcgcggcgagacgcgcatcatcgcggtcgacaatctgacgcgcgcggacaagttc
aagaacctcgtcgattgcgagatcgacgactacctcgacaagaccgaattcgccgagcgc
ttcgcgcgcggcgatttcggcaaggtgcgtgcggtgttccacgaaggcgcgtgttcggac
acgatggaacacgacggccgctacatgatggacaacaacttccgctacagccgcggcgtg
ctcgatgcgtgcctcgcacagggcgcgcagttcctgtacgcgtcgtcggcagcgacctac
ggcggctcgacgcgcttcgtcgaggagcgcgaggtcgaggcgccgctcaacatctacggc
tattcgaagttcctgttcgaccaggtgatccgccgcgtgcttccgagcgcgaagagccag
atcgccggcttccgttacttcaacgtgtatggcccgcgcgagacgcacaagggccgcatg
gcatcggtcgcgttccacaacttcaaccagttccgcgcggaaggcaaggtcaagctgttc
ggcgaatacaacggctacgcgccgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gtcgtgaaggtgaacctgttcttcttcgatcatccggagaagtcgggcatcttcaacctc
ggcaccggccgcgcgcagccgttcaacgacgtcgcgacgtcggtggtcaacacgctgcgc
gcgctcgacagcctgccgccgctgacgctcgcacagcaggtcgagcaggggctgatcgaa
tacgtgccgttcccggacgcgctgcgcggcaagtaccagtgcttcacgcaggctgaccag
acgaagctgcgcgcggccggctacgatgcgccgttcctgacggtgcaggaaggcgtcgac
cgttacgtacgttggctgtccggccaggtttaa

DBGET integrated database retrieval system