KEGG   Burkholderia stagnalis: WT74_14545Help
Entry
WT74_14545        CDS       T04885                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00903  Limonene and pinene degradation
bstg00930  Caprolactam degradation
bstg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    WT74_14545
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    WT74_14545
Enzymes [BR:bstg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     WT74_14545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AOK53818
Position
1:complement(3252028..3253008)
Genome map
AA seq 326 aa AA seqDB search
MSWQSKLACWLLRWQFRPETTRPVLDPARARRFTDRRMIVPRRAPSGYRLRECYGPDDAP
LRGEWLERVDGRTGQGSGQGTAQGRMLLYFHGGGYYFCSTKTHRPLVFGLTKRAGVRAFS
LDYRLAPEHRFPAALDDALAAYRRLLATGTPPESIVLGGDSAGGGLALATLVALRDRGEP
LPAGAILFSPWTDLAATGETLRTHDGIDPMFAGPALGKAAKLYLGDTPAAHPYASPLYAD
FTGLPPLFIQVGSTEVLLDDSRRVADKARAAGVQVEIEIWPQMPHVWQLYAPMVPESRQA
LDRAAAFLRRVAVERAVQRAGEVSIA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaagcaagctcgcctgctggctgctgcgttggcagttccgccccgagacc
acgcgtcccgtgctcgacccggcgcgcgcgcggcgctttaccgaccggcggatgatcgtg
ccgcgccgcgcgccgtccggctatcggctgcgcgaatgctacggcccggacgacgcgccg
ctgcgcggcgaatggctcgagcgtgtcgacgggcggaccgggcaggggtccgggcagggg
accgcgcaggggcgcatgctgctgtacttccacggcggcggctactacttctgctcgacc
aagacccatcgcccgctcgtgttcggcctgaccaaacgcgcgggcgtgcgcgcgttctcg
ctcgactaccgcctcgcgccggagcaccgcttcccggccgcgctcgacgatgcgctcgcc
gcctaccgccggctgctcgcgacgggcacgccgcccgagtcgatcgtgctcggcggcgat
tcggcgggcgggggcctcgcgctcgcgacgctcgtcgcgctgcgcgatcgcggcgagccg
ctgccggccggcgcgatcctgttctcgccgtggaccgatctcgcggcgaccggcgagacg
ctgcgcacgcacgacggcatcgatccgatgttcgccggcccggcgctcggcaaggcggcg
aagctgtatctcggcgacacgccggccgcccacccgtacgcgtcgccgctctatgcggat
ttcacggggctgccgccgctgttcatccaggtcggcagcaccgaggtgctgctcgacgat
tcgcgccgcgtcgccgacaaggcgagggccgccggcgtgcaggtcgagatcgagatctgg
ccgcagatgccgcacgtctggcagttgtatgcgccgatggtgccggaatcgcggcaggcg
ctcgatcgggcggccgcgttcctgcgccgggtcgcggtcgagcgcgcggttcagcgcgcg
ggcgaggtgtcgatcgcctga

DBGET integrated database retrieval system