KEGG   Burkholderia stagnalis: WT74_14600Help
Entry
WT74_14600        CDS       T04885                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00010  Glycolysis / Gluconeogenesis
bstg00020  Citrate cycle (TCA cycle)
bstg00620  Pyruvate metabolism
bstg01100  Metabolic pathways
bstg01110  Biosynthesis of secondary metabolites
bstg01120  Microbial metabolism in diverse environments
bstg01130  Biosynthesis of antibiotics
bstg01200  Carbon metabolism
Module
bstg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WT74_14600
   00020 Citrate cycle (TCA cycle)
    WT74_14600
   00620 Pyruvate metabolism
    WT74_14600
Enzymes [BR:bstg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     WT74_14600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AOK53827
UniProt: A0A118S494
Position
1:complement(3264330..3265442)
Genome map
AA seq 370 aa AA seqDB search
MKIFKLPDLGEGLQEAEIVEWHVKAGDTIDTDQPLLSVETAKAIVDIPSPQAGRIAKLFG
LAGDIVHLGAPLVAFEGDGDDADAGTVVGKVEVGAQVVHDAPAALGAGPGGAGAIKAMPA
VRALARKLDVDLAMVTPSGADGVITAADVQRVAKVLAEVGPAEVLRGVRRAMAQNMARAQ
SEVAAATVIDDADIHAWAPRTDVTIRLIRALVAGCRAEPVLNAWYEGHTGRRHVLAKIDV
GIAVDLPEGLFVPVLRDVAHRDAADLRAGLDRMRDDIRARKIPPEELRGNTITLSNFGMI
AGKYAAPVVVPPTVAILGAGRIHDGVVPVAGAAAVHRILPLSLTFDHRVVTGGEAARFLA
AAIADLQAAE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttcaagctgccggacctcggcgaagggctgcaggaagcggaaatcgtcgaa
tggcacgtgaaggcgggcgacacgatcgacaccgaccagccgctgctgtcggtcgagacc
gcgaaggcgatcgtcgacatcccgtcgccgcaggcgggccgcatcgcgaagctgttcggg
ctggccggcgacatcgtgcatctcggcgcgccgctcgtcgcattcgaaggcgacggcgac
gacgcggatgccggcaccgtggtcggcaaggtcgaggtgggcgcgcaggtcgtgcacgac
gcgccggcggcgctcggcgcgggccccggcggcgcgggggcgatcaaggcgatgcccgcg
gtgcgcgcgctcgcgcgcaagctcgacgtcgatctcgcgatggtcacgccgtcgggcgcg
gacggcgtgatcaccgcggccgacgtgcagcgggtcgcgaaggtgctcgccgaggtcggg
ccggcggaggtgctgcgcggcgtgcggcgcgcgatggcgcagaacatggcgcgcgcgcag
agcgaggtcgcggcggccacggtgatcgacgacgccgatatccacgcgtgggcgccgcgc
accgacgtgacgatccggctgatccgcgcgctggtggccggctgccgcgcggagccggtg
ctcaacgcgtggtacgaggggcatacggggcggcggcacgtgctcgcgaagatcgacgtc
ggcatcgcggtcgacctgcccgagggcctgttcgtgccggtgctgcgcgacgtcgcgcat
cgcgacgccgccgacctgcgggccggcctcgaccggatgcgcgacgacatccgcgcgcgc
aagattccgccggaggagctgcgcggcaacacgatcacgctgtcgaacttcgggatgatc
gccggcaagtacgcggcgcccgtggtcgtgccgccgacggtcgcgatcctcggcgcgggg
cgcatccacgacggcgtcgtgccggtcgccggcgcggccgccgtgcaccggatcctgccg
ctcagcctgaccttcgaccatcgcgtcgtgaccggcggcgaggcggcgcgctttctcgcg
gcggcgatcgccgacctgcaggcggcggagtag

DBGET integrated database retrieval system