KEGG   Burkholderia stagnalis: WT74_25395Help
Entry
WT74_25395        CDS       T04885                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00460  Cyanoamino acid metabolism
bstg00500  Starch and sucrose metabolism
bstg01100  Metabolic pathways
bstg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WT74_25395
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    WT74_25395
Enzymes [BR:bstg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     WT74_25395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like Toprim_3
Motif
Other DBs
NCBI-ProteinID: AOK56078
Position
2:complement(1181089..1183293)
Genome map
AA seq 734 aa AA seqDB search
MRINLWPAAVLLASLSTGACAAASADFTSPTDAVESFASAGAHRRADALVHRMTLDEKLQ
FIHSKYEMSQVPGGGAGYIQGVPRLGIPDLNMVDSATGSGSTSQASTTFPATIAVAASWD
RRLSYDYGRQVAIQLRAQGFGMGLGGGTNLAREPRGGRLFEYLGEDPLLAGDLLAERTLA
TQRHKVIATIKHYAANEQEHGRMGGNSQLDERTLRELYLLPFEIAAKRAQPGSVMCSYNR
LNGDYACENAHLLNDVLKNEWGFEGQVQSDWGATHSTAKAINAGLDEEEDVGPSVYLTPA
AVRQAIANGSVSTARLDDMVRRKLAAMIRIGVMDDPPKGGGAIDFASAGRFAQAAAEQSI
VLLKNDGNQLPLAAPALARIAVIGGHADAAVLSGGGSGNTRNPVTGAFAGCGGLAFGTST
GCSWWRNPWLKVDVPIVAAIRALAPAAQVTFAGNSDQQAPFRAYTQQEIDQAAALAARSD
VAIVVVAQPAGEDFGDLQSLALANPSNQDALVDAVARANPHTVVVVESGNPVLMPWKDRV
SAIVAAWYPGERGGAAIANVLFGKVNPSGKLPVTFPARDQDTPTWGQNGAFDNDPVYAEK
LNMGYRWYDAKNVKPMFEFGFGLSYTHFSYSGLAVSRQRDGSLDVAFTVRNDGPVAGAEV
PQVYLGVPYKDEPPRRLVGWDKIDLKPGEARRVHIGVPARLQSVWDTSRNGWRYVPGGTV
SVGASSRDIRLQGG
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaacctctggccggctgccgtgctgctggcgtccctcagcacgggcgcctgt
gcagcagcctcggccgatttcacctcgcccaccgacgccgtcgaatccttcgcatcggcc
ggcgcgcaccgtcgcgcggacgcgctcgtccaccggatgacgctcgacgagaagctccag
ttcatccactcgaaatacgagatgtcgcaagtgcccggcggcggcgccggctatatccag
ggcgtgccgcggctcggcattccggacctgaacatggtcgattcggcaaccggctccggc
agcacgtcgcaggccagcacgaccttccccgcgacgatcgccgtggccgcgagctgggat
cgccgcctgtcgtacgactacggccggcaggtcgcgatccagttgcgcgcgcaaggattc
ggcatgggcctcggcggcggcaccaacctcgcgcgcgagccgcgcggcggccggctgttc
gagtatctcggcgaggatccgctgcttgccggcgacctgctcgccgagcgcacgctcgcg
acgcagcggcacaaggtgatcgcgaccatcaagcactacgcggccaacgagcaggagcac
ggccggatgggcggcaacagccagctcgacgagcgcacgctgcgcgagctctacctgctg
ccgttcgagatcgccgcgaagcgcgcgcagccgggcagcgtgatgtgcagctacaaccgg
ctgaacggcgactatgcgtgcgagaacgcgcatctgctgaacgacgtgctgaagaacgaa
tggggcttcgaaggccaggtgcaatccgactggggcgcgacgcacagcaccgcgaaggcg
atcaatgcgggcctcgacgaggaggaagacgtcgggccgagcgtgtacctgacgccggcg
gcggtgcggcaggcgatcgcgaacggctcagtgtcgaccgcgcggctcgacgatatggtg
cgccgcaagctggccgcgatgatccgcatcggcgtgatggacgatccgcccaagggcggc
ggcgcgatcgacttcgcgtcggccgggcgcttcgcacaggcggccgccgaacagtcgatc
gtgctgctcaagaacgacggcaaccagctgccgctcgcggcgcccgcgctggcgcgcatc
gcggtgatcggcggacacgcggacgcggccgtgctgtccggcggcggctccggcaacacg
cgcaatccggtcacgggcgcgttcgcgggctgcggcggcctcgcgttcggcacgtcgacc
ggctgcagctggtggcgcaacccgtggctgaaggtcgacgtgccgatcgtcgcggcgatc
cgcgcgctcgcgcccgccgcgcaggtcacgttcgccggcaacagcgaccagcaggcgccg
ttccgcgcctatacgcagcaggagatcgaccaggcggccgcgctcgcggcgcgctcggac
gtcgcgatcgtcgtggtcgcgcagccggccggcgaggatttcggcgacctgcaaagcctc
gccctcgcgaacccgtcgaaccaggacgcgctcgtcgacgcggtcgcgcgcgcgaatccg
cataccgtcgtcgtggtcgagagcggcaatccggtgctgatgccgtggaaggaccgcgtg
tccgcgatcgtcgcggcgtggtatccgggcgaacgcggcggcgcggcgatcgcgaacgtg
ctgttcggcaaggtcaacccgtccggcaagctgcccgtcacgttccccgcgcgcgaccag
gacacgcccacctgggggcagaacggcgcgttcgacaacgatcccgtctatgcggaaaag
ctgaacatgggctaccggtggtacgacgcgaagaacgtgaagccgatgttcgagttcggc
ttcggcctgtcgtatacgcacttctcgtactccgggctcgccgtgtcgcggcagcgcgac
ggctcgctggacgtcgcgttcaccgtgcgcaacgacggccccgtggccggcgcggaagtg
ccgcaggtgtatctcggcgtgccatacaaggacgagccgccgcgccgcctggtcggctgg
gacaagatcgacctgaagccgggcgaagcgcggcgcgtgcacatcggcgtgccggcgcgg
ctgcagagcgtgtgggacacgtcgcgcaacggctggcgctacgtgccgggcggcaccgtg
tccgtcggcgcgtcgtcgcgcgacatccggctgcaaggcggctaa

DBGET integrated database retrieval system