KEGG   Burkholderia stagnalis: WT74_27315Help
Entry
WT74_27315        CDS       T04885                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00071  Fatty acid degradation
bstg00072  Synthesis and degradation of ketone bodies
bstg00280  Valine, leucine and isoleucine degradation
bstg00310  Lysine degradation
bstg00362  Benzoate degradation
bstg00380  Tryptophan metabolism
bstg00620  Pyruvate metabolism
bstg00630  Glyoxylate and dicarboxylate metabolism
bstg00640  Propanoate metabolism
bstg00650  Butanoate metabolism
bstg00900  Terpenoid backbone biosynthesis
bstg01100  Metabolic pathways
bstg01110  Biosynthesis of secondary metabolites
bstg01120  Microbial metabolism in diverse environments
bstg01130  Biosynthesis of antibiotics
bstg01200  Carbon metabolism
bstg01212  Fatty acid metabolism
bstg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WT74_27315
   00630 Glyoxylate and dicarboxylate metabolism
    WT74_27315
   00640 Propanoate metabolism
    WT74_27315
   00650 Butanoate metabolism
    WT74_27315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WT74_27315
   00072 Synthesis and degradation of ketone bodies
    WT74_27315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WT74_27315
   00310 Lysine degradation
    WT74_27315
   00380 Tryptophan metabolism
    WT74_27315
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WT74_27315
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WT74_27315
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WT74_27315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bstg04147]
    WT74_27315
Enzymes [BR:bstg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WT74_27315
Exosome [BR:bstg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WT74_27315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOK57545
Position
2:1642342..1643526
Genome map
AA seq 394 aa AA seqDB search
MSTREVVICHPVRTPIGTFNGSLKDTPATELGAIAVRETLRRSSLDGAAVDTVVMGNVIQ
AGNKMNPARQASIGAGIPVAVPALTVNRVCGSGAQAIVNAAQEIMLGFANAAVAGGMESM
ERAPYLLDGARWGYRMGQAPILDSMLRDGLVDAFSDQHSGWHTEDLASQLDISRDRQDRW
ALRSQQRFSAALAGGKFDAELVPVEILQRKARVAFARDETPRPDTTLDTLAKLKPAFRPD
GTITAGNAPGLNSGASAMLVADRAFADAHGIAPSARVVSFGIAAVEPGMFGLGPVPAVKI
ALERAGWALRDVERFEINEAFAVVPIAVAGQLGIDEEIVNVDGGAIAHGHAIGATGAVLT
TRLIHSMKRDGIKRGVVTLCIGGGQGIALAIETL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacgcgaagtcgtcatctgccatcctgtccgaacgccgatcggcacgttcaac
ggctctttgaaggacacgcccgcgaccgagctcggcgcgatcgccgtgcgcgaaaccctg
cggcgcagcagcctggatggcgcggccgtcgacacggtcgtgatgggcaacgtgatccag
gccggcaacaagatgaaccccgcacggcaggcgtcgatcggcgccggcattccggtcgcg
gtgcccgcgctgacggtcaaccgggtctgcggctccggcgcgcaggcgatcgtcaatgcc
gcgcaggagatcatgctgggcttcgcgaacgcggccgtcgccggcggcatggaaagcatg
gagcgcgcgccgtacctgctcgacggcgcccgctggggctaccggatgggccaggccccg
atcctcgacagcatgctgcgcgacggcctcgtcgatgcattctccgaccagcattccggg
tggcataccgaggatctcgcgagccagctcgacatctcgcgcgaccgccaggaccgctgg
gcgctgcgctcgcagcagcgcttctccgccgcactggccggcgggaagttcgacgccgag
ctggtgccggtcgagatcctgcagcgcaaggcgcgcgtggcgttcgcgcgggacgagacg
ccccgccccgatacgacgctcgacacgctcgcgaaactgaaacccgcgttccgcccggac
ggcacgatcaccgccggcaatgcgccgggcctgaacagcggcgcatcggcgatgctggtg
gcggaccgcgcgttcgccgacgcgcacgggatcgcaccgagcgcccgcgtcgtgtcgttc
ggcatcgccgccgtcgagcccgggatgttcggcctgggccccgttcccgcggtgaagatc
gcgctcgaacgcgccggctgggcgctgcgcgacgtcgagcgcttcgagatcaacgaggcg
ttcgcggtcgtgccgatcgcggtggcgggccagctcggcatcgacgaggagatcgtcaac
gtggacggcggcgcgatcgcgcacggccacgcaatcggcgcgacgggcgcagtgctgacc
acgcgcctgatccactcgatgaagcgcgacggcatcaagcgcggcgtggtgacgctgtgc
atcggcggcggccagggcatcgcgctcgcgatcgagacgctctga

DBGET integrated database retrieval system