KEGG   Burkholderia stagnalis: WT74_30140Help
Entry
WT74_30140        CDS       T04885                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00051  Fructose and mannose metabolism
bstg01100  Metabolic pathways
bstg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WT74_30140
Enzymes [BR:bstg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     WT74_30140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C PepSY
Motif
Other DBs
NCBI-ProteinID: AOK56902
Position
2:complement(2316302..2317579)
Genome map
AA seq 425 aa AA seqDB search
MPIIRSMRVVDVRFPTSRQLDGSDAMNPDPDYSAAYVVLDTDRDGLAGHGLTFTIGRGNE
ICCAAIDAMRHLVVGLDLDWIRADMGRFWRHMTSDSQLRWIGPDKGAIHLATGAVVNAVW
DLWAKAEGQPLWRLVAGLSPEELVRAIDFRYLRDCLTEDDALAILRRQAPGKAERIATLE
RDGYPCYTTSAGWLGYSDDKLRRLCQQAVDAGFDHVKLKVGANLEDDIRRVTIAREVIGP
DRKLMIDANQVWEVDEAIDWVRELAFARPWFIEEPTSPDDIEGHRKIRDAIAPVQVATGE
MCQNRVMFKQFIARGAIDVVQIDACRLGGVNEILGVMLLAAKYGLPVCPHAGGVGLCEYV
QHLSMIDYVCISGTKEGRVTEYVDHLHEHFVTPCVVRGAAYLPPDAPGFSIEMKRESLER
YRFRG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcattcgatcgatgcgcgtcgtcgacgtgcgctttccgacctcgcgccagctc
gacggctccgacgcgatgaacccggaccccgactactcggccgcctacgtggtgctcgac
accgatcgcgacggcctcgcgggccacgggctcacgttcacgatcgggcgcggcaacgag
atctgctgcgcggcgatcgacgcgatgcggcatctcgtcgtcgggctggacctcgactgg
atccgcgcggacatggggcgcttctggcggcacatgacgtcggacagccaactgcgctgg
atcgggcccgacaagggcgcgatccatctcgcgaccggcgcggtggtcaacgcggtgtgg
gatctgtgggcgaaggcggaaggccagccgctgtggcggctcgtcgcggggctgtcgccg
gaggagctggtgcgggcgatcgacttccgctacctgcgcgactgcctgaccgaggacgac
gcgctcgcgatcctgcggcgccaggcgccgggcaaggccgagcgcatcgcgacgctcgag
cgggacggctacccgtgctacacgacgtcggcgggctggctcggctacagcgacgacaag
ttgcgccgcctgtgccagcaagcggtcgatgcggggttcgaccatgtgaagctgaaggtc
ggcgcgaacctcgaggacgacatccgccgcgtgacgatcgcgcgcgaggtgatcggcccc
gaccgcaagctgatgatcgacgcgaaccaggtgtgggaagtggacgaggcgatcgactgg
gtgcgcgagctcgcgttcgcgcggccgtggttcatcgaggagccgacgagccccgacgac
atcgagggccatcgcaagatccgcgacgcgatcgcgcccgtgcaggtcgcgaccggcgag
atgtgccagaaccgcgtgatgttcaagcagttcatcgcgcgcggcgcgatcgacgtcgtg
cagatcgacgcgtgccggctcggcggcgtcaacgagattctcggcgtgatgctgctggcc
gcgaaatacgggctgccggtgtgcccgcatgcgggcggcgtcgggctgtgcgaatacgtg
cagcacctgtcgatgatcgactacgtgtgcatatccggcacgaaggaagggcgcgtgacc
gagtacgtcgatcatctgcacgagcatttcgtcacgccgtgcgtggtgcgcggcgcggcc
tatctgccgccggacgcgcccggcttctcgatcgagatgaagcgcgaatcgctggagcgg
tatcgcttccgcggctga

DBGET integrated database retrieval system