KEGG   Burkholderia stagnalis: WT74_31305Help
Entry
WT74_31305        CDS       T04885                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bstg  Burkholderia stagnalis
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    WT74_31305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Yip1
Motif
Other DBs
NCBI-ProteinID: AOK57112
Position
2:2615703..2615912
Genome map
AA seq 69 aa AA seqDB search
MLTSGAVDVYGLPVSTTHVLSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIALAGA
LYWVFRSLG
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgagcggcgcggtcgacgtctacgggctgccggtgtcgacgacgcacgtgctg
tcgtcgggcgtcgccggcacgatggccgcgaacggctcggggctgcagtggagtacggtg
cgcagcctcgtgctggcgtgggtgctgacgctgcccgcgtcgatcgcgcttgccggcgcg
ctgtattgggtgtttcgttcactagggtga

DBGET integrated database retrieval system