KEGG   Burkholderia stabilis: BBJ41_02990Help
Entry
BBJ41_02990       CDS       T04946                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00230  Purine metabolism
bstl00250  Alanine, aspartate and glutamate metabolism
bstl01100  Metabolic pathways
Module
bstl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BBJ41_02990
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBJ41_02990
Enzymes [BR:bstl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BBJ41_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AOR66609
UniProt: A0A1D7Z9J9
Position
1:620349..621695
Genome map
AA seq 448 aa AA seqDB search
MSASAVNVTPGRNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLIIGGKKT
ILRLIPSGIMREGVACYIGNGVVLSPEALFKEIGELEEAGVNVRDRLFISEATTLILPYH
IAIDQAREARKGAGKIGTTGRGIGPAYEDKVGRRALRVQDLFDAKTFADRLRENLDFHNF
VLTQYLGGAAVDFQATLDTMLGYADRLKPMVADVSRRLYDANNAGQNLLFEGAQGTLLDI
DHGTYPFVTSSNCVAGAASAGAGVGPQKLNYILGITKAYCTRVGSGPFPSELYDADNPQR
QDQVGVTLANVGKEFGSVTGRPRRTGWLDAAALRRSIQINGVSGLCMTKLDVLDGLDEVK
LCVGYKIDGKDADILPRGAADVARCEPVYETFPGWKESTVGIKTWEALPANAQAYLSRVQ
EVAGVPVDMVSTGPDRDETILLRHPFKV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcgcagtgaacgtgactcccgggcgcaatgtcgtcgtcgtgggaactcaa
tggggtgatgaaggcaagggcaagatcgtcgactggctgacggaccacgctcagggcgtc
gtgcgtttccagggcggccacaacgccggccacaccctcatcatcggcggcaagaaaacg
atcttgcgcctcattccgtcgggcatcatgcgtgaaggcgtcgcctgctacatcggcaac
ggcgtcgtcctgtcccccgaagcactgttcaaggaaatcggcgagctcgaagaggccggc
gtgaacgtgcgcgaccgtctgttcatttccgaagccacgacgctgatcctgccgtatcac
atcgcgatcgaccaggcgcgcgaagcgcgcaagggcgcgggcaagatcggcacgacgggc
cgcggcatcggccccgcgtacgaagacaaggtcggccgccgcgcgctgcgcgtgcaggac
ctgttcgacgcgaagaccttcgccgaccgcctgcgcgaaaacctcgatttccacaacttc
gtgctgacccagtacctgggtggcgcggccgtcgatttccaggccacgctcgacacgatg
ctcggctatgccgaccgcctgaagccgatggtggccgacgtgtcgcgccgcctgtacgac
gcgaacaacgcgggccagaacctgctgttcgaaggcgcgcagggcacgctgctcgacatc
gaccacggcacctatccgttcgtcacgtcgagcaactgcgtcgcgggtgcggcatcggcc
ggcgcgggcgtcggtccgcagaagctgaactacattctcggcatcacgaaggcctattgc
acgcgcgtcggctcgggcccgttcccgagcgagctgtacgatgcggataacccgcagcgt
caggaccaggtcggcgtcacgctcgcgaacgtcggcaaggaattcggttcggtcaccggc
cgtccgcgccgcaccggctggctcgacgccgccgcgctgcgccgctcgatccagatcaac
ggcgtgtcgggcctgtgcatgacgaagctcgacgtgctcgacggcctcgacgaagtcaag
ctgtgcgtcggctacaagatcgacggcaaggatgcagacatcctgccgcgtggcgcagcc
gacgtggcgcgttgcgaacctgtgtacgaaacgttccccggctggaaggaaagcacggtc
ggcatcaagacctgggaagcattgccggcgaacgcgcaggcatacctgtcccgtgtccag
gaagtggctggtgtgccggtcgacatggtgtcgacgggcccggaccgcgacgaaacgatc
ctgctccgccatccgttcaaggtgtaa

DBGET integrated database retrieval system