KEGG   Burkholderia stabilis: BBJ41_06260Help
Entry
BBJ41_06260       CDS       T04946                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00562  Inositol phosphate metabolism
bstl00564  Glycerophospholipid metabolism
bstl00565  Ether lipid metabolism
bstl01100  Metabolic pathways
bstl01110  Biosynthesis of secondary metabolites
bstl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBJ41_06260
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBJ41_06260
   00565 Ether lipid metabolism
    BBJ41_06260
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBJ41_06260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bstl02042]
    BBJ41_06260
Enzymes [BR:bstl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BBJ41_06260
Bacterial toxins [BR:bstl02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BBJ41_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal UCR_Fe-S_N Pea-VEAacid
Motif
Other DBs
NCBI-ProteinID: AOR67185
UniProt: A0A1D7ZBK7
Position
1:1361028..1363172
Genome map
AA seq 714 aa AA seqDB search
MTRSNRRDFLRVAAGTAGAAALNLFPPVIRDALAIPANRRTGTIRDIEHIVILMQENRSF
DHYFGTMRGVRGFGDPRPLRLANGKSVFHQPVGPAELLPFHPGADKLGLQFLQDLPHGWQ
DMHAAWNKGRYDQWVPNKGTTTMAYLKRDDIPFHYQLADAFTICDAYHCAIPSSTDPNRY
YMWTGYVGNDGTGGGPVLGNEEKGYGWTTYPEVLEQAGVSWKIYQDVGTGLDANGSWGWT
QNPYIGNYGDNSLLYFNQYRTALPGTPLYEKARTGTNISAGGTLFDVLQQDVKNGTLPQV
SWICAPEAYSEHPNWPANYGAWYIEQVLKALVSNPDVWSKTALFITYDENDGFFDHVPPP
FAPQSRDNGLSSVATTNEVFPGDASHMAGPYGLGPRVPMLVVSPWTKGGWVCSQTFDHTS
LLQFIEARFGAQYPVKAANVSPWRRTVCGDLTAAFDFATSDAAWPTLPDTSSYAPPDRLR
HPDYIPVPPVLQKLPKQEAGLRPARALPYELFVHGRVEAANGQFRLTFANTGRAGAAFQV
QSRNRLDGPWAYTVEAGKRIADTWSAAASLGLYDLDVYGPNGFYCHFRGPFATGIGSANV
NPEVIYGYDVANGNITLRLMNRGHKAVRLKVTNAYGHGRARTFDLAPGAHVDDYWDLRGS
HGWYDLTVSDGRLLGFLRRFAGHVETGRPSTSDPLIRTTAFHDDAEAASDTLSD
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgacccgatcgaaccgtcgtgacttcctgcgcgtcgccgccggcactgccggcgccgcc
gcattgaacctgtttccgcccgtgatccgagatgcgctcgcgattcccgcgaaccgccgc
accggcacgatccgcgacatcgaacacatcgtgatcctgatgcaggagaaccgttcgttc
gaccattacttcggcacgatgcgtggtgtccgcggcttcggcgatccgcgcccgctgcgc
ctcgcgaacggcaagtcggtgttccatcagccggtcggcccggccgagctgctgccgttc
caccctggcgcggacaagctcggcctgcagttcctgcaggacctgccgcacggctggcag
gacatgcacgccgcgtggaacaaaggccgctacgaccagtgggtgccgaacaagggcacc
acgacaatggcgtacctgaagcgcgacgacatcccgttccactaccagctcgccgacgcg
ttcacgatctgcgacgcgtaccactgcgcgatcccgagctcgaccgacccgaaccgctat
tacatgtggacgggctacgtcggcaacgacggcacgggcggcggcccggtgctcggcaac
gaggaaaagggctacggctggacgacctatccggaagtgctcgaacaggccggcgtgtcg
tggaagatctaccaggacgtcggcacgggactcgacgcgaacggctcgtggggctggacg
cagaatccgtacatcggcaactacggcgacaactcgctgctctacttcaaccagtaccgc
accgcgctgcccggcacgccgctgtacgagaaggcgcgcaccggcaccaacatcagcgcg
ggcggcacgctgttcgacgtgctgcagcaggacgtgaagaacggcacgctgccgcaggtg
tcgtggatctgcgcgccggaagcgtactccgagcacccgaactggccggcgaactacggc
gcgtggtacatcgagcaggtgctgaaggcactcgtgtcgaatccggacgtgtggagcaag
accgcgctcttcattacgtacgacgagaacgacggcttcttcgaccacgtgccgccgccg
ttcgcgccgcaatcgcgcgacaacgggctgtcgtcggtcgcgacgaccaacgaagtcttc
cccggcgacgcgtcgcacatggccggcccgtacgggctcgggccgcgcgtgccgatgctg
gtcgtgtcgccgtggaccaagggcggctgggtctgctcgcagaccttcgatcacacgtcg
ctgctgcaattcatcgaggcgcggttcggcgcgcaatacccggtcaaggccgccaacgtg
tcgccgtggcgccgcacggtgtgcggcgacctgaccgccgcgttcgacttcgcgacgtcc
gatgccgcctggccgacgctgcctgacacgagcagctacgcgccgcccgaccgcctgcgc
caccccgactacatcccggtgccgccggtgctgcagaagctgccgaagcaggaggccggg
ctgcgtccggcgcgcgcgctgccgtacgagctgttcgtgcacggccgcgtcgaagccgcg
aacggccagttccggctgaccttcgcgaacaccggccgggcgggcgcggcattccaggtc
cagtcgcgcaaccgcctcgacggcccgtgggcgtacacggtcgaagccggcaagcggatc
gccgatacgtggagcgccgcggcgtcgctcggcctgtacgatctcgacgtgtacggcccg
aacggcttctactgccatttccgcggcccgttcgcgaccggcatcggcagcgccaacgtg
aaccccgaggtgatctacggttatgacgtcgcgaacggcaacatcacgctgcgcctgatg
aaccgcggccacaaggccgtgcggctcaaggtcacgaacgcatacggccacggccgcgcg
cgtacgttcgatctcgcgccgggcgcgcacgtcgacgactactgggacctgcgcggcagc
cacggctggtacgacctgaccgtcagcgacggccggctgctcggcttcctgcgccgcttc
gcgggccacgtcgagacgggccgcccgagcaccagcgatccgctgatccgcacgaccgcg
ttccacgacgacgcggaagctgcatcggacaccctgtccgactga

DBGET integrated database retrieval system