KEGG   Burkholderia stabilis: BBJ41_12445Help
Entry
BBJ41_12445       CDS       T04946                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bstl  Burkholderia stabilis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BBJ41_12445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AOR68280
UniProt: A0A1D7ZEG2
Position
1:2660777..2661151
Genome map
AA seq 124 aa AA seqDB search
MSQYQFTVSVKTSYLPEQSDPDHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESHVQE
VKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtatcagttcaccgtttcggtgaaaaccagctacttgccggaacaatccgac
cccgatcaccgtcaatatgcattcgcgtacacgctgacgatccgcaacacgggacaagtc
gcggcgcagctgatcgcgcgtcactggatcatcacggacagcgagagccacgtgcaggaa
gtgaaggggctcggcgtcgtcgggcaccagccgctgctgcagccgggcgagcacttcgaa
tacacgagctgggccgtgatcgcgacgccggtcggcacgatgcgcggcgcgtacttctgc
gtggcggaggacggcgagcgtttcgaggcgccggtcgacgagttcgcgttgcacatgccg
cgcacgctgcattga

DBGET integrated database retrieval system