KEGG   Burkholderia stabilis: BBJ41_14910Help
Entry
BBJ41_14910       CDS       T04946                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00071  Fatty acid degradation
bstl00072  Synthesis and degradation of ketone bodies
bstl00280  Valine, leucine and isoleucine degradation
bstl00310  Lysine degradation
bstl00362  Benzoate degradation
bstl00380  Tryptophan metabolism
bstl00620  Pyruvate metabolism
bstl00630  Glyoxylate and dicarboxylate metabolism
bstl00640  Propanoate metabolism
bstl00650  Butanoate metabolism
bstl00900  Terpenoid backbone biosynthesis
bstl01100  Metabolic pathways
bstl01110  Biosynthesis of secondary metabolites
bstl01120  Microbial metabolism in diverse environments
bstl01130  Biosynthesis of antibiotics
bstl01200  Carbon metabolism
bstl01212  Fatty acid metabolism
bstl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBJ41_14910
   00630 Glyoxylate and dicarboxylate metabolism
    BBJ41_14910
   00640 Propanoate metabolism
    BBJ41_14910
   00650 Butanoate metabolism
    BBJ41_14910
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBJ41_14910
   00072 Synthesis and degradation of ketone bodies
    BBJ41_14910
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBJ41_14910
   00310 Lysine degradation
    BBJ41_14910
   00380 Tryptophan metabolism
    BBJ41_14910
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBJ41_14910
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBJ41_14910
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBJ41_14910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bstl04147]
    BBJ41_14910
Enzymes [BR:bstl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBJ41_14910
Exosome [BR:bstl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBJ41_14910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOR69518
UniProt: A0A1D7ZI19
Position
1:3197636..3198817
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPEQVSEVIMGQVLTAG
SGQNPARQSLIKAGLPTAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVIAGGQENMSA
SPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREEQDAFAA
LSQNKAEAAQKAGRFDDEIVPVSIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFSKDG
SVTAANASGLNDGAAAVLVMSAQKAAALGLTPLAKIKAYANAGVDPSVMGMGPVPASRRC
LERAGWTPGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMAKRDAKRGLASLCIGGGMGVALAVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtagtgatcgtatcggccgcgaggaccgcggtcggcaaattcggcggctcg
cttgcgaagattgcggcgccggagctgggcgcgacggtgatccgcgcggtgctggagcgt
gcgggcgtgaagcccgagcaggtcagcgaagtgatcatggggcaggtgctgacggccggt
tcggggcagaacccggcgcggcagtcgctgatcaaggccgggctgccgacggcagtgccg
gggatgacgatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggcggcgaac
gcgatcgtggcgggtgacgcggagatcgtgatcgcgggcggtcaggagaacatgagcgca
tcgccgcacgtgctgccgggctcgcgcgacgggttccggatgggcgatgcgaagctggtc
gacacgatgatcgtcgacggcctgtgggacgtgtacaaccagtaccacatgggcatcacg
gcggagaacgttgcgaaggaatacggcatcacgcgcgaagagcaggacgcattcgcggcg
ctgtcgcagaacaaggcggaagccgcacagaaagccgggcgctttgacgacgagatcgtg
ccggtgtcgattccgcaacgcaagggcgagccgctgcagttcgcgaccgacgagttcgtg
cgtcacggcgtgacggcggaatcgctggcggggctgaagccggcattctcgaaggacggc
tcggtgacggcggcgaacgcgtcggggctgaacgacggtgcggcggcggtgctggtgatg
tcggcgcagaaggcggcggcgctgggcctgacgccgctcgcgaagatcaaggcgtatgcg
aatgcgggcgtggatccgagcgtgatggggatgggcccggtgccggcctcgcgccggtgc
ctggagcgcgcgggctggacgccgggcgacctggacctgatggagatcaacgaggcgttc
gcggcgcaggcgctggcggtgcacaagcagatgggctgggacacgtcgaaggtgaacgtg
aacggcggggcgatcgcgatcggtcacccgatcggcgcgtcgggctgccggatcctggtg
acgctgctgcacgagatggccaagcgcgatgcgaagcgcgggctggcgtcgctgtgcatc
ggcggcgggatgggtgtcgcgctcgcggtcgagcgcgtctga

DBGET integrated database retrieval system