KEGG   Burkholderia stabilis: BBJ41_21640Help
Entry
BBJ41_21640       CDS       T04946                                 

Definition
(GenBank) D-serine ammonia-lyase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00260  Glycine, serine and threonine metabolism
bstl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBJ41_21640
Enzymes [BR:bstl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     BBJ41_21640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AOR70178
UniProt: A0A1D7ZK10
Position
2:791157..792482
Genome map
AA seq 441 aa AA seqDB search
MTIALQPTDLLAKLQSRHPLLWLNPGAGRPLPHDAPSFDAIAMAEARLARCEPLMAELFP
ELAASAGKIESPLMPADDLQRALSHPADARGAWFIKRDDALPIAGSIKARGGFHEVLALA
ESLAIEHGLLDPAGDRRTLASTAARALFAAHTVIVGSTGNLGLSIGVMAAALGFESVVHM
STEAKPWKKARLRNRGVRVIEHDGDYAQAVAAGRAQAHNQPRCHFVDDEGSLMLFLGYAA
SARHLAAQLAEAGRGVDAAHPLFVHIPCGVGGAPGGIAYGLKALFGEHVHCFFAEPVASP
CMLVQLASGRREPLSVYDVGLDNRTEADGLAVAQASHLVSPLMAPLLSGVFTVSDAQLYA
QLLAVQRALGVELEPSAAAAVGGPGWLERSPAGQDYVRNLAIDMHRSTHVIWATGGSLVP
PDEHRRFQAHAKALAGGAPGV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgactatcgcgctccaacctaccgatctattagccaaactgcaatcccgccacccgctc
ctgtggctgaacccgggtgccggccgccccttgccccacgacgcgccatcgttcgacgcc
attgcgatggccgaagcgcggctcgcgcgctgcgagccgctgatggccgaactttttccc
gagctcgcggcgagtgcgggaaaaatcgagtcgccgctgatgcccgcggacgacttgcag
cgcgcgttgtcgcacccggccgacgcgcgtggcgcgtggttcatcaagcgcgacgacgcg
ttgccgattgccggttcgatcaaggcacgcggcggttttcacgaagtgctcgcgctcgcc
gagtcgctcgcgatcgaacacgggctgctcgaccccgcgggagaccggcgaactcttgcg
tcgaccgcggcgcgcgcactgtttgccgcgcacaccgtcatcgtgggcagcaccggcaat
ctcggcctgagcatcggcgtgatggccgccgcgctggggttcgaatcggtcgttcacatg
tcgaccgaagcgaagccctggaaaaaggcgcgcctgagaaatcgcggcgtgcgcgtgatc
gagcacgacggcgattacgcacaagccgtcgcggccggacgcgcgcaggcacacaatcaa
ccgcgctgccatttcgtcgacgacgaaggctcgctgatgctgttcctcggctacgcggca
agcgcccggcatctcgccgcgcaactcgccgaggcgggccgcggcgtggacgccgcacat
ccacttttcgtccatatcccctgcggtgtcggcggtgcgccgggcggcatcgcgtatggc
ctcaaggcgcttttcggcgagcacgtgcattgctttttcgccgagcccgtcgcttcgccc
tgcatgctggtccagcttgcgtccggtcgccgcgagccgctgtccgtctacgacgtgggg
ctcgacaaccggaccgaggccgacggcctcgccgtcgcgcaggcgtcgcatcttgtcagc
ccgctgatggcgccgctgctgtcgggcgtgttcaccgtcagcgacgcgcagctctacgcg
caactgctcgcggttcagcgcgcgctgggcgtggaactggaaccgtcggccgcggctgcc
gtcggcgggcccggctggctggaacggtcgccggccggccaggactacgtacgcaatctc
gcgatcgacatgcaccggtcgacgcacgtcatctgggcgacgggcggatcgctcgtcccg
ccggacgagcaccgccgcttccaggcccatgcgaaagcgctcgccggtggcgcgcccggc
gtgtga

DBGET integrated database retrieval system