KEGG   Burkholderia stabilis: BBJ41_23395Help
Entry
BBJ41_23395       CDS       T04946                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bstl  Burkholderia stabilis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BBJ41_23395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOR70491
UniProt: A0A1D7ZKY1
Position
2:complement(1219241..1220830)
Genome map
AA seq 529 aa AA seqDB search
MPNLAATETSGAVSHRTRTISLALFFLIIAFGIVYVGIHLSADLSPVKESSILPFLLLIV
ALLIALGFEFVNGFHDTANAVATVIYTHSLDPHLAVVWSGLWNLFGVLVSSGAVAFGIVQ
LLPVELILQVGSGAGFAMVFSLLIAAVTWNLATWYFGLPSSSSHTLVGSIIGVGLMNQIV
SGPSGTSGVDWNQALGVGKALLFSPLIGFVLSALVLLLLKALVRVPALYQEPKGNKPPPF
WIRLLLILTCTGVSFAHGSNDGQKGMGLIMLILIGVMPTAYALNKAVTPDQTSTFVAVAR
HASATLVKYADPAAQSADPRTDVETYVRTHKLTPVTLPALGKLTDTIADQVAQAGGISSV
PQNLVDNVRNNMYVASEAIRLMEKAKAPAFSVEDASALDAFKKQMDRATKFIPTWVKVAV
AIALGLGTMVGWKRIVVTVGEKIGKSHLTYGQGASAEAVAMLTIGMADAYGLPVSTTHVL
ASGVAGTMTASGAGLRWDTVRNLVLAWVLTLPASIALSAALYWALHGLF
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatctcgcggcaacggaaaccagcggtgcggtcagccatcgcacgcgcaccatc
agcctcgcgctgtttttcctgatcattgccttcggcatcgtctatgtcgggattcatctg
agcgccgacctcagcccggtcaaggaaagctcgatcctcccgttcctgctgctgatcgtc
gcgctgctgatcgcgctcggcttcgagttcgtgaacggctttcacgacaccgcgaacgcg
gtcgcgaccgtcatctacacgcattcgctcgacccgcatctcgcggtggtctggtcgggg
ctctggaacctgttcggcgtgctcgtgtcgagcggcgccgtcgcattcggcatcgtgcag
ctgctgcccgtcgagctgatcctgcaggtcggcagcggcgcgggcttcgcgatggtgttc
tcgctgctgatcgcggccgtcacgtggaacctcgcgacctggtatttcgggctgccgtcg
tcgagctcgcacacgctcgtcgggtcgatcatcggcgtcggcctgatgaaccagatcgtc
agcggcccgtcgggcacgagcggcgtcgactggaaccaggcgctcggcgtcggcaaggcg
ctgctgttctcgccgctgatcggcttcgtgctgtccgcactggtgctgctgctgctgaag
gcgctcgtgcgcgtgccggcgctgtaccaggagccgaagggcaacaagccgccgccgttc
tggatccgcctgctgctgattctgacgtgcaccggcgtgtcgttcgcgcacggctcgaac
gacgggcaaaagggcatgggcctgatcatgctgatcctgatcggcgtgatgccgaccgcc
tacgcgctgaacaaggccgtgacacccgaccagacgagcacgttcgtcgcggtcgcgcgc
cacgcgtcggcgacactcgtcaagtacgccgacccggccgctcagtccgccgacccgcgc
accgacgtcgagacgtacgtgcgcacgcacaagctgacgcccgtgacgctgcccgcgctg
ggcaagctcaccgacacgatcgccgaccaggtcgcgcaggcaggcggcatctcgagcgtg
ccgcagaacctcgtcgacaacgtgcgcaacaacatgtacgtcgcgtccgaggcgatccgc
ctgatggagaaggcgaaggcgccggcgttctcggtcgaggacgcgagcgcgctcgacgcg
ttcaagaagcagatggaccgcgcgacgaaattcatcccgacgtgggtgaaggtcgcggtc
gcgatcgcgctcggactcggcacgatggtcggctggaagcggatcgtcgtgacggtcggc
gagaagatcggcaaatcgcatctcacgtacgggcagggcgcgtcggccgaggccgtcgcg
atgctgacgatcggcatggccgacgcatacgggctgccggtatcgacgacgcacgtgctc
gcgtcgggcgtggccggcacgatgacggcgagcggcgcgggcctgcgctgggacacggtg
cgcaacctcgtgctcgcatgggtgctgacgctgcccgcgtcgatcgcgctgtcggccgcg
ctgtactgggcgctgcacgggcttttctga

DBGET integrated database retrieval system