KEGG   Burkholderia stabilis: BBJ41_27740Help
Entry
BBJ41_27740       CDS       T04946                                 

Definition
(GenBank) aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00860  Porphyrin and chlorophyll metabolism
bstl01100  Metabolic pathways
bstl01110  Biosynthesis of secondary metabolites
bstl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBJ41_27740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bstl01007]
    BBJ41_27740
Enzymes [BR:bstl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BBJ41_27740
Amino acid related enzymes [BR:bstl01007]
 Aminotransferase (transaminase)
  Class III
   BBJ41_27740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOR71271
UniProt: A0A1D7ZN30
Position
2:2213969..2215327
Genome map
AA seq 452 aa AA seqDB search
MQIRHGVDLIRARALFDRERRAFAEAMPASRALSAEASEHLLFGVPLHWMQDWSTPFSLY
VKEARGATFTDVDGHRYVDFCLGDTGAMFGHAPEPVARALVEQATRGYTTMLPSEDAAWV
SRELARRFRLPVWQFALSASDANRFVLRWARAATGRNTIVVFNGCYHGTVDDVFVDLVDG
RPVQRDSLLGQSWDLLASTRVVEFNDLDALEAALKQGDVACVLAEPAMTNIGMVLPDPGF
WQAARELTRRYGTLLVIDETHTISSGPGGYAAAHDLDPDLLVVGKPIAGGVPCAVYGFSA
ELAERAKQAKLNAPPGHSGIGTTLTANMLAMHAMRATLAEVATDAAYAHMFELAARLAAG
LERAIAKHGLPWCVTRIGARTEFQFAPTPPRNGTIAGTQLDSELEHIVHLYLLNRGVLIT
PFHNMMLVCPQTTHDDVHKLVAQFDACLGELV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttgcagatccgccacggagtcgacctcatccgcgcccgcgccctgttcgatcgcgagcgc
cgtgcgttcgccgaagccatgccggcctcccgcgcgttgtccgcggaagcgtccgagcac
ctgctcttcggcgtgccgttgcactggatgcaggactggtcgacgccgttctcgctgtac
gtgaaggaagcgcgcggcgcgacgttcaccgacgtcgacggccatcgctacgtggacttc
tgcctcggcgacacgggcgcgatgttcggccatgcacccgagccggtcgcccgcgcactc
gtcgaacaggccacgcgcggctacacgacgatgctgccgagcgaagacgccgcctgggta
tcgcgcgaactcgcgcgccgcttccggctgccggtctggcagttcgcgctgagcgcgagc
gacgcgaaccgcttcgtgctgcgctgggcgcgcgcggccaccggccgcaacacgatcgtc
gtgttcaacggctgctatcacggcacggtcgacgacgtgttcgtcgatctcgtcgacggc
cgccccgtgcagcgcgacagcctgctcgggcagtcctgggacctgcttgccagcacgcgc
gtcgtcgagttcaacgacctggacgcgctcgaagcggcgctgaagcagggcgacgtcgca
tgcgtgctcgccgagccggcgatgacgaacatcgggatggtgctgcccgatcctggcttc
tggcaggccgcgcgcgaactgacgcgccgctacggcacgctgctcgtgatcgacgaaacg
cacacgatcagcagcggcccgggcggctacgcggccgcgcacgatctcgacccggacctg
ctggtggtcggcaagccgatcgcgggcggcgtgccgtgcgcggtgtacggcttcagcgcc
gaactcgcggaacgcgcgaagcaggcgaagctgaacgcgccgcccggccattccgggatc
ggcacgacgctcaccgcgaacatgctcgcgatgcacgcgatgcgcgcgacgctggccgaa
gtcgcgaccgacgccgcatatgcgcacatgttcgaactcgccgcgcggctggcggccggc
ctcgaacgcgcgatcgcaaaacacgggctgccgtggtgcgtgacgcgcatcggcgcgcgc
accgagttccagttcgcgcccacgccgccgcgcaacggcacgatcgccggcacgcaactc
gacagcgagctcgaacacatcgtgcacctgtacctgctgaatcgcggcgtgctgatcacg
ccgttccacaacatgatgctcgtatgcccgcagacgacgcacgacgacgtccacaaactc
gtcgcgcagttcgacgcgtgcctcggcgaactggtgtga

DBGET integrated database retrieval system