KEGG   Burkholderia stabilis: BBJ41_27795Help
Entry
BBJ41_27795       CDS       T04946                                 

Definition
(GenBank) gluconolaconase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00053  Ascorbate and aldarate metabolism
bstl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BBJ41_27795
Enzymes [BR:bstl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BBJ41_27795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Phytase-like PD40
Motif
Other DBs
NCBI-ProteinID: AOR71281
UniProt: A0A1D7ZN37
Position
2:complement(2228028..2228930)
Genome map
AA seq 300 aa AA seqDB search
MQQIQPAASATLLADSRNTLGEGATWCDATHTLYWVDIEGAQLWRCRADGSDLTPWTMPE
RLACFALTGDPDVLLVGLATHLAFFDLRSGALTRIVDVEPDLPTRLNDGRCDPSGAFVFG
MKDEGSEPPRAVGGFYRLNADLTLERLALPAAAIANSIAFSPNGSKMYFCDSLVREIFVC
DYRAGGDVANVRSFARLTDADGDPDGATMDRDGGLWNAQWGGRRVVRYGPDGVETDRVDV
PTAQPSCAALDGEGRLYVTSARIGLSDDALAGDAHAGGVFVARTRYAGLPTARFAGAPRG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagattcaaccggccgcgtcggcgacgctgctggccgacagccgcaacacgctc
ggcgaaggcgcgacgtggtgcgatgcgacgcatacgctgtactgggtcgacatcgaaggt
gcgcagttgtggcgatgccgcgcggacggttccgacctgacgccgtggacgatgccagaa
cggctcgcatgcttcgcgctgaccggcgatccggacgtgctgctcgtcgggctcgcgacg
catctcgcgttcttcgacctgcgcagcggcgcgctcacgcggatcgtcgacgtcgagccc
gatctgccgacgcgcctgaacgacgggcgctgcgatccgtccggcgcgttcgtgttcggg
atgaaggacgaaggcagcgagccgccgcgcgcggtcggcgggttctaccggctcaatgcc
gacctcacgctcgagcggctcgcgttgccggcggcggcgatcgcgaacagcatcgcgttc
tcgccgaacggttcgaaaatgtatttctgcgattcgctcgtgcgcgagattttcgtctgc
gattaccgtgcgggcggcgacgtcgcgaacgtgcggtcgttcgcgcgcctgaccgatgcg
gacggcgacccggacggcgcgacgatggatcgcgacggtgggctgtggaacgcgcagtgg
ggcggccggcgcgtggtgcgttatgggccggacggcgtggaaacggatcgcgtcgacgtg
ccgactgcacagccgagctgtgcggcgctcgacggcgaagggcggctgtacgtgacgagc
gcgcgcatcggattaagcgacgatgcgctggccggcgatgcacacgccggcggcgtattc
gtcgccaggacgcgctacgcggggttgccaaccgcgcgattcgcaggggcgccgcgcggc
tga

DBGET integrated database retrieval system