KEGG   Burkholderia stabilis: BBJ41_29480Help
Entry
BBJ41_29480       CDS       T04946                                 

Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
bstl  Burkholderia stabilis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBJ41_29480
Enzymes [BR:bstl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     BBJ41_29480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 NodS MTS SnoaL_2 Methyltransf_4 MDMPI_N FtsJ Methyltransf_32 PCMT CMAS
Motif
Other DBs
NCBI-ProteinID: AOR71586
UniProt: A0A1D7ZNZ1
Position
2:2603838..2604623
Genome map
AA seq 261 aa AA seqDB search
MTTPLDQYANQYVQFEDERTRPVRDLLAAVPNTPIHTAIDIGCGPGNSTEALIARAPDAT
IHGIDASADMIAAARKRLPGLRFDIADVAAWDDPGGYDLILSNAVLQWVPAHDTLFPMLV
GRLAPGGHLAVQMPDNLHEPAHRLMREVAAAGPWADKLKGAARTERFDARYYYALLSPLC
ARVDVWRTTYYHPLRGGADAVVEWFKGSALRPFLAALDDGEQRAFLARYRDALAGPNGYP
ALGDGTVLLPFPRLFIVATRK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccccactcgatcaatacgcgaaccagtacgtgcaattcgaggacgaacgcacg
cggccggtgcgcgacctgctggccgccgtgccgaacacgccgatccataccgcgatcgac
atcggctgcgggcccggcaattcgacggaagcattgatcgcacgcgcacccgacgcgacg
atccacgggatcgacgcatcggcggacatgatcgcggccgcgcgcaagcgcctgccgggg
ctgcgtttcgatatcgccgacgtggccgcgtgggacgacccgggcggctatgacctgatc
ctgtcgaacgcggtattgcaatgggtgcctgcgcacgacacgctgtttccgatgctcgtc
ggccggctcgcgccgggcggccatctggcggttcagatgcccgacaacctgcacgagccc
gcgcaccggctgatgcgcgaagtcgccgcggcggggccgtgggcggacaagctgaaaggt
gcggcgcgcacggagcggttcgacgcacggtactactacgcgctgctgtcgccgctgtgc
gcgcgcgtggacgtgtggcgcacgacttactaccacccgctgcgcggcggcgccgacgcg
gtggtcgaatggttcaagggcagcgcgctgcggccgttcctcgccgcgctcgatgacggc
gaacagcgcgcgttcctcgcgcgctatcgcgatgcgctcgccggccccaacggttatccg
gcgctcggcgacggcaccgtgctgttgccgttcccgcgtctgttcatcgtcgcgacgcgg
aagtga

DBGET integrated database retrieval system