KEGG   Bacteriovorax stolpii: C0V70_02865Help
Entry
C0V70_02865       CDS       T05263                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00061  Fatty acid biosynthesis
bsto00071  Fatty acid degradation
bsto01100  Metabolic pathways
bsto01212  Fatty acid metabolism
bsto02024  Quorum sensing
Module
bsto_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C0V70_02865
   00071 Fatty acid degradation
    C0V70_02865
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C0V70_02865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsto01004]
    C0V70_02865
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsto04147]
    C0V70_02865
Enzymes [BR:bsto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     C0V70_02865
Lipid biosynthesis proteins [BR:bsto01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   C0V70_02865
Exosome [BR:bsto04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   C0V70_02865
  Exosomal proteins of breast cancer cells
   C0V70_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2 DUF4235
Motif
Other DBs
NCBI-ProteinID: AUN97064
UniProt: A0A2K9NQM8
Position
614299..615960
Genome map
AA seq 553 aa AA seqDB search
MEKIWLKNYQSGVPATIEDQMQKYHSLGDLMDESFGKFSQVEAFNCMGKGLTYQEVDQLS
RQFASYLQNDLKLQKGDRVALMMPNILQYPVALFGILRGGFVAVNVNPLYTARELQHQLK
DSGAKAIVIFENACHTLQGVLDKTDCKHVLTTNIGDMLGFPKSMIVNFVIKKIKKMVPAW
SIPSAKSFMSELRMADASKFRKPSMSQSDIAFLQYTGGTTGVAKGAILTHQNMVANMCQA
RAWLSPAIGGQTEILISPLPLYHIFSLTVSMVFVSIGATNVLITNPRDMKAFIGELRKWK
FTVLPGVNTLFNGLLNQPDFKTLDFSTMKIALGGGMAVQKAVADKWKSVTGKVLLEAYGL
TETSPAACINPINLKDYNGFIGLPIPSTDVVIKDDNDKTLGLNEVGEICIKGPQVMPGYW
NRDDETAKVMTSDGYFKTGDIGFMNDQGYVKIVDRKKDMILVSGFNVYPNEIEDVVATHP
KVFEVAAIGVPDEKSTEAIKLFIVKKDESLTAEEVIAFCRKELTGYKVPKLVEFRTELPK
SNVGKILRKDLRN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttggcttaaaaactatcagtctggcgttcctgcgaccatcgaagatcag
atgcaaaagtaccattccttaggcgacttaatggatgagagttttggtaaattctctcaa
gtagaagcctttaattgcatgggcaaaggccttacttatcaagaggttgatcagctaagc
cgccagtttgccagctacctacaaaacgatcttaagctacaaaaaggggaccgcgtggcc
ctgatgatgcccaatattctgcaatacccagtggccttatttggtatcctaaggggtgga
ttcgtcgcagtaaacgtcaacccactttacacggcacgtgaacttcagcaccagctcaag
gactcgggggctaaggccatcgttattttcgaaaatgcctgtcatacccttcaaggggtc
ctggataagaccgactgtaaacatgttttgacaacaaatattggcgatatgcttggtttc
ccgaaatcgatgatcgtgaacttcgtgatcaagaaaattaagaaaatggttccagcgtgg
agtattccaagtgcgaagagttttatgtctgaactgcgcatggccgatgcaagtaaattt
agaaagccaagtatgagtcaatcagatatcgcttttttacaatacactggtggaacaaca
ggtgtagccaaaggtgctattctcactcatcaaaatatggtggcgaatatgtgtcaggcg
cgcgcgtggctttctccagcgattggcggacagacagaaattctcatttcaccacttccg
ctttaccacattttctcactgactgtttcaatggtgtttgtttcaattggagcgacaaac
gttctcattacaaacccaagagacatgaaggcctttattggtgagttgagaaaatggaag
tttacagttctcccgggtgtaaacacacttttcaatggcctattaaaccagccagatttt
aaaactctggatttctctacaatgaaaattgctcttggtggaggaatggccgtacaaaaa
gctgttgccgataaatggaaaagcgtgactggaaaagttttactcgaagcctatggatta
acagaaacatcaccagctgcttgtatcaaccctattaatctaaaagactataatggcttt
atcggtcttccgatcccttctacagacgtagtgatcaaagatgacaatgataaaacttta
ggtctgaatgaagtaggtgagatctgtattaaaggccctcaagtcatgccaggttactgg
aaccgcgatgatgaaacagcaaaagttatgacgtcggatggatactttaaaacaggtgat
atcggattcatgaatgaccaaggttatgtgaaaatcgtcgaccgtaaaaaagatatgatc
ctggtctcaggattcaacgtttatccaaatgagattgaagatgttgtggccactcatcca
aaagtatttgaagtggcggccatcggagttcctgatgagaaatcaacggaggccattaag
cttttcatcgtgaaaaaagatgaaagtttaacagcggaagaagtcattgctttctgccgc
aaagaactgactggatacaaagttccaaaactggttgagtttagaaccgaacttcctaag
agtaatgttggaaagattttaagaaaagacctaagaaactaa

DBGET integrated database retrieval system