KEGG   Bacteriovorax stolpii: C0V70_10340Help
Entry
C0V70_10340       CDS       T05263                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00471  D-Glutamine and D-glutamate metabolism
bsto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C0V70_10340 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsto01011]
    C0V70_10340 (murI)
Enzymes [BR:bsto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     C0V70_10340 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bsto01011]
 Precursor biosynthesis
  Racemase
   C0V70_10340 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AUN98497
UniProt: A0A2K9NSN0
Position
complement(2108594..2109388)
Genome map
AA seq 264 aa AA seqDB search
MDKKMNAPKHKIGVFDSGIGGFSVLNELLKAFPEAEYFYYSDDAHAPYGPKTDEYINQRT
FVITDELISQGVEMIVVACNTATAVSIDALRAAYPQMPFVGVEPYLNAYYKETGPSKMAV
LTTVSAGKSERFKRLKERLDPKGFIDHYSLQNLARMVEELYKHPEYEGEFDKLLVSELEP
LQGKQYTHAILGCTHYPLVRNKIEDVLKLKTLSPCPYVAQRVRELSVKPGEVPGDISETF
EFYSSSKPEWVKKNRSDFYYPFKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaaaaaatgaatgcacctaagcataagatcggcgtttttgattctggtatcggt
ggatttagtgtcctcaatgaactccttaaagcttttccagaagcagagtatttttactac
agcgatgatgctcatgctccctacggtcccaaaaccgacgaatacattaatcaaagaact
tttgtcattactgacgagttaatttctcagggagtggagatgattgttgtggcgtgcaat
accgcgacagctgttagtatcgatgccctgcgggccgcttatccgcagatgccttttgtc
ggcgtagagccttacctgaacgcttactacaaagaaaccggcccttctaagatggcggtg
ctgacaaccgtttcagcaggaaagtctgagcgttttaagcggttaaaggagcgtcttgac
ccaaaaggttttattgaccattattctctacaaaacctggcccgcatggtggaagagctc
tataaacatcccgagtatgagggagagttcgataagcttttagtgagtgagttagaacca
cttcaaggcaagcagtatacgcacgctattttggggtgcacgcattacccgttagtcaga
aacaaaattgaagatgtattaaaacttaaaacactttcaccttgcccttatgtggcccaa
agagtgagagagctttcagtcaagccgggagaagtgcccggtgatataagtgagactttt
gaattttattcaagcagtaaacccgagtgggtgaaaaaaaatcgctctgatttttattac
cccttcaaaaaataa

DBGET integrated database retrieval system