KEGG   Bacteriovorax stolpii: C0V70_11530Help
Entry
C0V70_11530       CDS       T05263                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bsto  Bacteriovorax stolpii
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C0V70_11530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4352 DUF5643
Motif
Other DBs
NCBI-ProteinID: AUN98722
UniProt: A0A2K9NT99
Position
2357293..2357733
Genome map
AA seq 146 aa AA seqDB search
MEQINPIEPNEYYFETTQDILIEVYPHYVPERSSPENNQYFYAYKIKITNNGEVACRVIH
RHWKIKDGNGKTYDVQGSGVVGEQPMLKSGESFEYTSFCPLHSPYGNMRGKYQMIDEFGN
RFWVTVPVFFFRPPRNLNEEGETVIQ
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggaacagattaatccaattgaacccaatgaatattattttgagacaactcaagatatt
ttaatcgaagtctaccctcattacgttcctgagcgctcatccccagagaacaatcagtac
ttttacgcttataaaatcaaaatcacgaacaacggtgaagtcgcttgtcgcgttatccac
cgccactggaagatcaaagacggaaacggaaaaacgtatgacgttcaaggatcaggtgtt
gttggtgagcagccaatgcttaaatcaggtgaatctttcgaatacacaagcttctgtcca
cttcactctccttatgggaatatgcgtgggaaataccagatgatcgatgaattcggaaac
cgcttctgggtgacagttcctgttttcttcttcagacctcctcgcaacttaaatgaagaa
ggcgaaaccgttattcaataa

DBGET integrated database retrieval system