KEGG   Bacteriovorax stolpii: C0V70_11720Help
Entry
C0V70_11720       CDS       T05263                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00540  Lipopolysaccharide biosynthesis
bsto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    C0V70_11720 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bsto01005]
    C0V70_11720 (rfaD)
Enzymes [BR:bsto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     C0V70_11720 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bsto01005]
 Unusual sugar
  C0V70_11720 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 ThiF KR TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AUN98756
UniProt: A0A2K9NTA4
Position
complement(2394805..2395782)
Genome map
AA seq 325 aa AA seqDB search
MILITGGAGFIGSVLAKQLNQLGHTDLVIVDKLEDSIKWKNLRGIKYLEYIHADELFGGD
YDDLIAETDLIFHMGACSATTEKNMDFLMKNNVAYTQALWRFAATKNIPFIYASSAATYG
DGELGYSDDHGMIPKLMPLNPYGYSKQLVDEWVLKEEQKPDHWFGLKFFNVYGPNEYHKD
DMKSLVCKAHEQIKSNGKVKLFKSHRPDFKDGEQLRDFIYVKDVVRAMIELADPDKAEFS
GIYNLGAGKARSFHDLVKATFSAMNVPANIEFIDMPESIRNQYQYYTQADTTKLMKAIPE
FQFTSLEDGVRDYVQNYLMKANPHC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgattttaattaccggaggcgcaggcttcattggaagtgtgctggcaaaacaattaaat
caactgggtcacaccgatcttgtgatcgtcgataaacttgaagacagcattaaatggaaa
aaccttcgcgggattaaataccttgagtacattcatgccgatgaacttttcggcggtgac
tatgacgatttaatcgctgagactgatttgatttttcacatgggagcttgttcagcgaca
actgaaaagaacatggacttcctgatgaaaaacaacgtggcctacactcaggccctgtgg
cgttttgccgctactaaaaacattccattcatctacgcaagctctgcggcgacttacggt
gatggcgagttaggttatagtgatgaccacggcatgatcccaaaactaatgccgttaaac
ccatacggttactcaaagcaattagtagacgagtgggtattaaaagaagaacaaaaacca
gatcactggtttggcctaaaattctttaacgtgtatggccccaatgagtatcacaaagac
gatatgaaatcgttagtgtgtaaggcccacgaacaaattaagtctaatggaaaagtaaaa
ctcttcaaatctcaccgcccggattttaaagacggtgaacaactaagagacttcatttac
gttaaagacgttgtccgcgcgatgattgaattagcagacccggataaggccgagttctca
ggaatttataacctgggggcaggcaaggcgagaagcttccacgatttagtgaaggcgact
ttttctgcgatgaatgttccggccaatatcgagtttattgatatgcctgaatcaatccgc
aaccaataccagtactacactcaggccgatacaacgaaattaatgaaggccattccagaa
tttcagtttacttcgcttgaagatggagtgcgcgattatgttcagaactatctgatgaag
gcaaaccctcactgctaa

DBGET integrated database retrieval system