KEGG   Bacillus subtilis subsp. subtilis 168: BSU00030
Entry
BSU00030          CDS       T00010                                 

Gene name
yaaA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: S4_2 AARP2CN
Other DBs
NCBI-GeneID: 939444
NCBI-ProteinID: NP_387884
Pasteur: BG10067
BSORF: BG10067
UniProt: P05650 A0A6M4JE10
Position
3206..3421
AA seq 71 aa
MANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEPDNRRGRKLYVGDVVE
IEGFGSFQVVN
NT seq 216 nt   +upstreamnt  +downstreamnt
atggcaaatccgatttcaattgatacagagatgattacactcggacaattcttaaaatta
gccgatgtgattcagtctggcggtatggcgaagtggtttttaagcgagcatgaagtgctt
gtgaacgatgagccggacaaccgccggggcagaaagctgtatgttggagatgtggtagag
attgaaggatttggttcatttcaagtcgtcaattaa

DBGET integrated database retrieval system