KEGG   Bacillus subtilis subsp. subtilis 168: BSU02120
Entry
BSU02120          CDS       T00010                                 

Gene name
ybeC
Definition
(RefSeq) amino acid-proton symporter YbeC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AA_permease_2 AA_permease DUF2981
Other DBs
NCBI-GeneID: 938442
NCBI-ProteinID: NP_388094
Pasteur: BG12730
BSORF: BG12730
UniProt: Q45577
Position
231348..232967
AA seq 539 aa
MNQLHRRMGTFSLMMVGLGSMIGSGWLFGAWRAAQIAGPAAIISWVIGMVVILFIALSYS
ELGSMFPEAGGMVKYTQYSHGSFIGFIAGWANWIAIVSVIPVEAVASVQYMSSWPWEWAK
WTSGLVKNGTLTGEGLAFASVLLLIYFLLNYWTVNLFSKANSLITIFKIIIPGLTIGALL
FVGFHGENFTGGQSIAPNGWASVLTAVATSGIVFAFNGFQSPINMAGEAKNPGKSIPIAV
VGSLFVATVIYVLLQIAFIGAVNPSDIAHGWSHLNFNSPFADLAIALNINWLVIVLYADA
FVSPSGTGITYTATTSRMIYGMEKNKYMPSIFGKLHPIYGVPRQAMFFNLIVSFIFLFLF
RGWGVLAEIISVATLISYITGPITVMTLRRTGKDLYRPLRLKGLNVIAPLGFIFASLVLY
WARWPLTGQVLFIILIGLPIYFYYQAKAKWKGFGRNFKAGVWMVFYLLAMMVISYLGSDK
FGGLNVIHYGWDMVLIAMVSLVFYVWALKSGYQTEYLKDAKEINSQLLNGQSEAAAGKE
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaatcaattgcatcgaagaatgggaacgttttccctcatgatggtcgggctcgggtcg
atgatcggttcaggctggctgttcggggcttggcgtgcggctcaaatagcaggaccagct
gctattatttcatgggttattggaatggtcgtcattttatttattgctctttcttatagt
gaactaggttctatgttccctgaagcggggggaatggtcaaatacacgcaatattcacac
ggttcgtttatcggttttattgcgggctgggccaactggattgcgattgtgtccgtcatt
ccggttgaagcggtggcctccgttcaatatatgagttcttggccttgggaatgggcgaaa
tggacaagcggtttggtgaagaatggaacgctgactggggaaggactagcgtttgcctct
gtattgcttctcatttattttctgctgaactactggacagtcaatctattttcgaaagcg
aattcattaattacgatttttaaaattattattccgggtcttacgattggagctttgctg
tttgtcggattccacggagaaaactttactggcggtcaaagcattgcgccgaatggctgg
gcaagtgtgctgacggcggttgccacttccggtatcgtttttgcgtttaatggtttccaa
agcccgattaatatggcgggtgaagcaaaaaatccggggaaatcaatcccgattgcggtt
gttggctctctttttgttgcgacagtgatttatgtcctgctgcagatcgccttcattgga
gctgtgaatccttctgatattgctcacggctggagccatctgaattttaattctcctttt
gctgatctggcgattgcgctgaatattaactggcttgttattgtgttatatgcagatgca
tttgtatcaccgtctggaacggggattacgtatacggcgacaacgtcccgaatgatttac
ggaatggaaaaaaacaaatacatgccgagtatattcgggaagcttcatccgatttacggc
gttccgcgacaagcaatgttctttaacttgattgtttcgttcatctttttgttcctgttc
agaggatggggcgtattagcggaaattatttctgttgctacgttaatttcttatatcacc
ggcccgatcacagtgatgacattgagacggacggggaaagacctgtacaggcctcttcgt
ttaaaaggcttaaatgtgattgctccgcttggatttatctttgcgtcactggtgctgtat
tgggcgcgctggccgttaacaggacaggttctgtttattatcctgatcggtcttccgatt
tatttctattatcaggcgaaggcgaaatggaaagggtttggccggaactttaaagccggc
gtctggatggtgttttatctgctggccatgatggttatttcttatttgggcagtgataaa
ttcggcggcctgaatgtcattcattatggctgggatatggttctgattgcgatggtatcc
cttgtattctatgtgtgggcgctgaagagcggctaccagacagaatacttaaaggatgcg
aaagagataaattctcagctgcttaatggacagtcagaagctgctgccggaaaagaataa

DBGET integrated database retrieval system