KEGG   Bacillus subtilis subsp. subtilis 168: BSU02360
Entry
BSU02360          CDS       T00010                                 

Gene name
nagBB
Definition
(RefSeq) glucosamine-6-phosphate deaminase 2
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU02360 (nagBB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     BSU02360 (nagBB)
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 938425
NCBI-ProteinID: NP_388118
Pasteur: BG12746
BSORF: BG12746
UniProt: O31458 A0A6M4JI37
Position
complement(256823..257572)
AA seq 249 aa
MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYKQLISDYQAGEIDFSK
VTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQGDNPQLEAACKVYEDLI
RQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQANARFFGGDPVLVPRLA
ISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPASILQKHNHVTVIADYKAA
QKLKSASFS
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagattctgatcgccgagcactacgaagaactctgtaagttaagcgctgccattatt
aaagaacaaatacaagctaagaaagatgccgttctcggcctggcaacaggaagcacaccg
gtcggcttgtataagcagttgatttcagactatcaggcaggcgaaattgatttttcaaag
gttactacatttaatttggatgaatatgctggtctctctccatctcatccgcaaagttat
aaccattttatgcatgagcatctttttcagcatatcaatatgcagcctgatcatattcat
atcccgcaaggagacaatccgcagcttgaggcggcatgcaaagtatacgaggatctcatc
cgccaggcgggaggcattgatgtccaaattctcggcatcggcgccaatggccatatcggt
tttaatgaaccgggatctgattttgaagaccggacacgtgttgtgaagctctcggaaagc
acgatacaggcaaatgccagattcttcggcggcgatccggtgctggttccgagactcgcg
atttcaatgggcattaaaaccatcatggaattcagcaaacatattgtgcttttagcaagc
ggcgaggaaaaagcagacgccattcaaaagatggctgaaggtcctgtcacgacagatgta
ccagcctccattcttcaaaaacacaatcatgtaaccgttatcgccgattataaagcagct
caaaaattaaagagtgcatcattctcataa

DBGET integrated database retrieval system