KEGG   Bacillus subtilis subsp. subtilis 168: BSU06190
Entry
BSU06190          CDS       T00010                                 
Symbol
ydjG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TF_Zn_Ribbon Zn_Tnp_IS1595 A2L_zn_ribbon Zn-ribbon_8 DZR zf_Rg zf-C2HC5 YjdM_Zn_Ribbon zf-LITAF-like DUF6487 Zn_Tnp_IS91
Other DBs
NCBI-GeneID: 939489
NCBI-ProteinID: NP_388500
Pasteur: BG12798
BSORF: BG12798
UniProt: O34434 A0A6M3Z8N5
Position
671994..673019
AA seq 341 aa
MIISYKCPNCGSDMAFDSETGSLSCSSCGRQDNIESLPKENIAARFSDDEAKEYQCKNCG
AVLITEAETTATTCSFCGGAAILADRLSGHLAPAKVIPFTISKQEAEQAFRKWCKKGLLT
PRGFMSADRIKSITGMYIPFWMFDLNSEVQVRANCTRVHQYEEGDYICTETEHFEAFRDI
NLDYLKIPVDASEKMKDELMDKLEPYSYEELKDFQTAYLAGYIAEKYNYTDEELFPRAKE
KISSYIDSYIHSTFSGYTSVNVRDKHIHTKNVNSFYVLLPVWMVSYDYERAEHIFAMNGQ
TGKVVGKPPISRGKVAAWFSGIAGGTFLALKLVSLMMGGGF
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgataatatcttataagtgtccgaactgcggcagtgatatggcatttgacagtgaaacc
ggctcgttatcctgcagcagctgcggaagacaggacaatattgaaagccttccgaaagaa
aacattgcggcacggttttctgatgatgaagcaaaagaatatcaatgtaaaaactgcggt
gccgttttgatcacggaagctgaaacgacagcaacgacgtgcagcttctgcggaggtgct
gcaatacttgccgatcgtttatcaggacatttggcgccggcgaaggtcattccatttaca
atcagcaagcaagaagcggagcaggcatttcgaaagtggtgcaaaaaaggccttctgaca
ccaagaggtttcatgtctgctgatcgtatcaaaagcatcaccggcatgtatattccattt
tggatgtttgatttaaatagtgaagtacaggtgagagcaaactgtaccagagtccatcaa
tatgaagaaggggattatatttgcacggaaacagagcactttgaagcgtttcgtgatatc
aatctcgattatttgaaaatccctgtcgatgcctctgaaaaaatgaaagacgaattaatg
gacaaattggagccttattcatacgaagagctgaaggactttcaaacggcatatttggcc
ggttatattgcggaaaagtacaattataccgatgaggagctttttccgagggcaaaagag
aaaatcagcagttatatagattcatacatccattctactttttccggatatacgtcagtc
aatgtgagggacaaacatattcacacgaaaaacgtgaacagcttttacgttttgcttcct
gtttggatggtcagttacgattatgaaagagcggagcatatctttgcgatgaacgggcaa
acaggaaaggtcgttggaaagccgccgatcagtcgaggaaaagtggctgcatggtttagc
ggaatagcaggcgggacatttcttgcgttgaagctcgtctcattgatgatgggaggcgga
ttttga

DBGET integrated database retrieval system