KEGG   Bacillus subtilis subsp. subtilis 168: BSU09230Help
Entry
BSU09230          CDS       T00010                                 

Gene name
yhcV
Definition
(RefSeq) CBS domain-containing protein YhcV
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 939740
NCBI-ProteinID: NP_388804
Pasteur: BG11600
BSORF: BG11600
UniProt: P54606
Position
997175..997597
Genome map
AA seq 140 aa AA seqDB search
MSSVKDTMTTQVATVSPNQTIQEAASLMKQHNVGAIPVVEQGVLKGMLTDRDIALRTTAQ
GRDGQTPVSEVMSTELVSGNPNMSLEDASQLMAQHQIRRLPIVDQNNLVGIVALGDLAVN
QMSNESAGSALTNISHQNIH
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagttaaagatacaatgacaacgcaggtggcaaccgtttctccgaatcaaacg
attcaggaagcggcttctctaatgaaacagcataacgtcggggcgatccccgttgtagag
caaggtgttttaaaaggaatgctgactgaccgtgacattgcattaagaactacagctcag
ggccgtgatggccagacacccgtttcagaagtgatgtcaacagaactcgtatcaggaaac
cctaatatgagtctggaagacgcgtcgcagctgatggcccagcaccaaatccgccgcctt
cctattgtagatcaaaacaatctagtcgggatcgttgcgcttggagacctggcagtcaat
cagatgtcgaacgagtctgcgggatcagcgctgacaaacatttctcaccaaaacattcat
taa

DBGET integrated database retrieval system