KEGG   Bacillus subtilis subsp. subtilis 168: BSU23850
Entry
BSU23850          CDS       T00010                                 

Gene name
zwf
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU23850 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU23850 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU23850 (zwf)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BSU23850 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BSU23850 (zwf)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSU23850 (zwf)
  Exosomal proteins of colorectal cancer cells
   BSU23850 (zwf)
  Exosomal proteins of bladder cancer cells
   BSU23850 (zwf)
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 938690
NCBI-ProteinID: NP_390266
Pasteur: BG11739
BSORF: BG11739
UniProt: P54547 A0A6M4JL49
Position
2479156..2480625
AA seq 489 aa
MKTNQQPKAVIVIFGATGDLAKRKLYPSIHRLYQNGQIGEEFAVVGVGRRPWSNEDLRQT
VKTSISSSADKHIDDFTSHFYYHPFDVTNPGSYQELNVLLNQLEDTYQIPNNRMFYLAMA
PEFFGTIAKTLKSEGVTATTGWSRLVIEKPFGHDLPSAQALNKEIREAFTEDQIYRIDHY
LGKQMVQNIEVIRFANAIFEPLWTNRYISNIQITSSESLGVEDRARYYEKSGALRDMVQN
HIMQMVALLAMEPPIKLNTEEIRSEKVKVLRALRPIAKDEVDEYFVRGQYHAGEIDGVPV
PAYTDEDNVAPDSNTETFVAGKLLIDNFRWAGVPFYIRTGKRMKEKSTKIVVQFKDIPMN
LYYGNENNMNPNLLVIHIQPDEGITLYLNAKKLGGAAHAQPIKLDYCSNCNDELNTPEAY
EKLIHDCLLGDATNFAHWDEVALSWSFVDSISETWAANKTLSPNYESGSMGPKESDDLLV
KDGLHWWNI
NT seq 1470 nt   +upstreamnt  +downstreamnt
gtgaaaacaaaccaacaaccaaaagcagtaattgtcatattcggtgcaactggagattta
gcaaaacgaaaattgtatccgtctattcaccgtttatatcaaaacggacaaatcggagaa
gagtttgcagtggtaggagttggaagaagaccttggtctaatgaggatcttcgccaaact
gttaaaacatccatttcctcatctgcagataagcatatagatgatttcacgtctcatttt
tactatcacccgtttgacgtgacaaaccctggttcttatcaagagctaaacgtattgctt
aaccagctggaagatacatatcaaattcctaacaacagaatgttctacttggcaatggct
cctgaattcttcggaacgattgcaaaaacattaaaatcagagggtgtaacagctacaacc
ggctggtcccgccttgtcatcgaaaaaccgttcggccatgatctgccaagcgcacaggca
ttgaataaagaaatccgcgaagcatttacggaagatcaaatttacagaatcgaccattat
ctaggcaaacaaatggttcagaacattgaagtgattcgatttgccaatgcgattttcgaa
ccgctttggacaaaccgctacatttcaaacattcaaatcacatctagcgaatcactaggc
gttgaagaccgcgcaagatattacgaaaaatcaggcgcccttcgcgacatggtgcaaaac
catattatgcagatggttgcccttcttgcaatggagccgcctatcaaattgaacacagaa
gaaatccgcagcgagaaagtgaaggtgctgagagcactgcgtcctattgcaaaagacgaa
gtggatgaatactttgtgcgcggacaatatcatgctggtgaaattgacggtgtaccggtt
cctgcttatacagatgaagataatgtcgctcctgactccaatacagaaacctttgttgcc
ggcaagctcttgatcgacaacttcagatgggctggtgttccattctacatcagaaccgga
aaacgaatgaaagaaaagtccacaaaaattgtcgttcaatttaaggacattccgatgaac
ctgtactacggtaatgaaaacaacatgaatccgaacttgcttgtcattcatattcagcct
gacgaaggcattacgctttacttaaatgctaaaaagcttggcggagcagcacacgcacag
ccaatcaaactcgattattgcagcaattgcaatgacgagttgaacacccctgaagcatat
gaaaaactaattcacgactgtcttcttggcgatgcaacaaactttgcacactgggatgaa
gttgccctttcttggagctttgtcgactctatttctgaaacatgggcagcaaacaaaacc
ttatctcctaactacgaatcaggctcaatgggaccgaaagaatctgatgatcttttggtg
aaagacggcttacactggtggaacatataa

DBGET integrated database retrieval system