KEGG   Bacillus subtilis subsp. subtilis 168: BSU29620
Entry
BSU29620          CDS       T00010                                 

Gene name
hisJ
Definition
(RefSeq) histidinol-phosphatase
  KO
K04486  histidinol-phosphatase (PHP family) [EC:3.1.3.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU29620 (hisJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     BSU29620 (hisJ)
SSDB
Motif
Pfam: PHP PHP_C
Other DBs
NCBI-GeneID: 937924
NCBI-ProteinID: NP_390840
Pasteur: BG13931
BSORF: BG13931
UniProt: O34411
Position
3031614..3032420
AA seq 268 aa
MQKRDGHIHTPFCPHGSNDTLRQYAEEALKKGFESITFTEHAPLPPSFTDPTPLKDSAMA
QASLERYIHEISGLKKEYRGQLSIRTGLEVDYIAEFEDEITLFLDTYGPYLDDSILSVHF
LRTDSSYLCLDYDEHTFKELISACGSIEAVYEQYYRSIYSSIVASLGVYKPKRVGHITLV
QKFIKLFPYSMSEHIRGLVSLCLNAIEENGMELDFNTSGLRKTYAGGIYIEDWMLNEAKQ
KKIPLVFGSDAHQAGDVGYAYEAFLERC
NT seq 807 nt   +upstreamnt  +downstreamnt
atgcaaaagcgagacggacatattcacacaccattttgccctcacggctccaatgacaca
ctcagacaatatgcagaagaagccttaaaaaaagggttcgaatcgattacttttaccgaa
cacgccccattgccgccatcttttaccgatcccacgccgctgaaagacagcgcgatggcg
caagcttctttggaacgctatattcatgaaatttccggattaaaaaaagaatatcgcgga
cagcttagcatacggacagggcttgaagtcgattatatcgctgaatttgaagacgaaatt
acattattcctagacacatacgggccatatttagatgacagcatcttatccgttcatttt
ttgcgcacagactcttcctatctatgccttgattatgacgagcataccttcaaagagctg
atttcagcctgcggaagcattgaagcggtatatgaacaatattaccggagtatctattct
tccattgtagcatctctcggcgtttataagccaaaaagagtcggtcacatcacactcgtc
caaaaattcatcaagctgtttccatacagcatgtcagagcatattcgcggcctcgtttct
ctgtgcctgaatgccattgaagaaaacggaatggagctcgacttcaatacttccggctta
agaaaaacttacgctggcggtatttatatcgaggattggatgctgaatgaagcgaagcaa
aagaagatcccgcttgtgtttgggtctgatgcccatcaagcgggagatgtcggatatgcg
tatgaggcgtttttggaacggtgctag

DBGET integrated database retrieval system