KEGG   Bacillus subtilis subsp. subtilis 168: BSU33620
Entry
BSU33620          CDS       T00010                                 

Gene name
yvaK
Definition
(RefSeq) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU33620 (yvaK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BSU33620 (yvaK)
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 DLH Peptidase_S9 DUF2048 Abhydrolase_6 BAAT_C UPF0227 ABC_tran_Xtn TMP_2
Other DBs
NCBI-GeneID: 938643
NCBI-ProteinID: NP_391242
Pasteur: BG14066
BSORF: BG14066
UniProt: O32232
Position
complement(3454221..3454967)
AA seq 248 aa
MSMKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPE
ELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPM
HIKSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVD
MIYSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVY
EFLEKLDW
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagcatgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtg
cttttgctgcatggctttacaggaaatacagcggatgtaaggatgctgggacgatatttg
aatgaacgcggctatacgtgccacgcgcctcaatatgaaggacatggcgtcccgcctgaa
gaacttgtacatacggggcccgaagactggtggaaaaacgtaatggatggctatgaatat
ttaaaatctgaaggttatgagagcattgctgcctgcggactgtcgcttggcggggttttt
tcgctgaaattgggttacactgtacccataaagggaattgtcccaatgtgcgcaccgatg
catattaagagtgaagaggtcatgtatcaaggcgttctttcatacgctcgcaattacaaa
aagtttgaggggaaaagcccggagcaaattgaagaggaaatgaaagaattcgaaaaaacg
ccgatgaataccctcaaggcgctgcaagacttaattgctgatgtgcggaataatgtcgat
atgatttattcaccgacatttgtggtgcaggcccgtcatgaccacatgattaataccgaa
agcgccaatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgag
gaatcagggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtat
gaatttttagagaagctcgattggtaa

DBGET integrated database retrieval system