KEGG   Bacillus subtilis subsp. subtilis 168: BSU34830
Entry
BSU34830          CDS       T00010                                 

Gene name
yvzA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: KN17_SH3 Sec7_N NACHT_N DUF4570
Other DBs
NCBI-GeneID: 936541
NCBI-ProteinID: NP_391363
Pasteur: BG14157
BSORF: BG14157
UniProt: O32265 A0A6M3ZGY5
Position
complement(3579679..3580038)
AA seq 119 aa
MTSLFSESETEIVSTTYMFLTQDEMKGKAGTLNQPINDFLSLTKKFESSLKEEIKGQKGL
IVKKIKKELESNSEKRKAALQMIKEEHTAKVDRYKMIIEDLRQQDVTLTYRKKKPVKDV
NT seq 360 nt   +upstreamnt  +downstreamnt
gtgacttccttattttcagaaagtgaaacagaaattgtatcaacgacctatatgtttctt
acccaagatgaaatgaaggggaaagcgggcaccctcaatcaaccgatcaacgactttctc
agcctgacaaagaaatttgagtcttcattaaaagaggaaatcaaagggcaaaaagggttg
attgtaaaaaaaataaaaaaagagcttgagtctaatagcgaaaaacgaaaagctgccctt
cagatgataaaagaagaacataccgcaaaagttgatcggtacaaaatgataatagaagac
ctgcgacagcaggatgtaacattgacttacagaaaaaagaagccagtgaaagatgtctaa

DBGET integrated database retrieval system