KEGG   Bacillus subtilis subsp. subtilis 168: BSU40420Help
Entry
BSU40420          CDS       T00010                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
Module
bsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU40420 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU40420 (purA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BSU40420 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF664
Motif
Other DBs
NCBI-GeneID: 937805
NCBI-ProteinID: NP_391922
Pasteur: BG10002
BSORF: BG10002
UniProt: P29726
Position
complement(4155433..4156725)
Genome map
AA seq 430 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIKFDGITYKLHLIPSGIF
YKDKTCVIGNGMVVDPKALVTELAYLHERNVSTDNLRISNRAHVILPYHLKLDEVEEERK
GANKIGTTKKGIGPAYMDKAARIGIRIADLLDRDAFAEKLERNLEEKNRLLEKMYETEGF
KLEDILDEYYEYGQQIKKYVCDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPTKIKHVVGVSKAYTTRVGDGPFPTELKDEIGDQIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLAGIETLKICVAYRYKGEIIEEFPASL
KALAECEPVYEEMPGWTEDITGAKSLSELPENARHYLERVSQLTGIPLSIFSVGPDRSQT
NVLRSVYRAN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtagttgtagtaggtacgcaatggggcgatgaaggaaaaggtaaaattaca
gatttcctatcagaaaatgcagaagtgatcgcccgttatcaaggcggaaataacgcaggg
catacaatcaagtttgacggaatcacatataagcttcacttaatcccgtctggaattttc
tataaggataaaacgtgtgtaatcggaaacggaatggttgtagatccgaaagcattagtc
acagagcttgcgtatcttcatgagcgcaacgtgagtacagataacctgagaatcagcaac
agagctcacgtcattctgccgtatcatttgaaattggatgaagtggaagaagagcgtaaa
ggggctaacaagatcggcacaacgaaaaaaggaatcggccctgcttacatggataaagca
gcccgcatcggaattcgcatcgcggatctgttagaccgtgacgcgtttgcggaaaagctt
gagcgcaatcttgaagaaaaaaaccgtcttctcgagaaaatgtacgagacagaagggttt
aaacttgaggatatcttagacgaatattatgagtacggacagcagattaaaaagtatgtt
tgcgatacatctgttgtcttaaacgatgctcttgatgaagggcgccgtgtattatttgaa
ggcgcacaaggggttatgctcgatatcgaccaaggaacatacccgtttgttacgtcatct
aacccggttgccggcggtgtcacgatcggttctggtgtcggcccgaccaaaatcaagcac
gttgtcggtgtatcaaaagcatatacgactcgtgtcggcgacggtccttttccgactgag
ctgaaagatgaaatcggcgatcaaatccgtgaagtcggacgcgaatatggaacaacaaca
ggccgcccgcgccgtgtcggctggtttgacagcgttgttgtccgccacgcccgccgtgtg
agcggaattacagatctttctctgaactcaattgacgtcctagcaggaattgaaacgttg
aaaatctgtgtggcgtaccgctacaaaggcgaaatcattgaagaattcccagcaagtctt
aaggcacttgctgaatgtgagccggtatatgaagaaatgccgggctggactgaggatatt
acaggtgcgaagagcttgagcgagcttccggaaaatgcgcgccattatcttgagcgtgtg
tctcagctgacaggcattccgctttctattttctctgtcggtccagaccgctcacaaaca
aatgtccttcgcagtgtgtaccgtgcgaactaa

DBGET integrated database retrieval system