KEGG   Bacillus subtilis subsp. subtilis 168: BSU00010Help
Entry
BSU00010          CDS       T00010                                 

Gene name
dnaA
Definition
(RefSeq) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU00010 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU00010 (dnaA)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU00010 (dnaA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU00010 (dnaA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BSU00010 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AAA_14 AFG1_ATPase RNA_helicase ATPase_2 DNA_pol3_a_NII DUF2075 AAA_19
Motif
Other DBs
NCBI-GeneID: 939978
NCBI-ProteinID: NP_387882
Pasteur: BG10065
BSORF: BG10065
UniProt: P05648
Structure
PDB: 

Position
410..1750
Genome map
AA seq 446 aa AA seqDB search
MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLH
LIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTF
VIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYL
SSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEES
KQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEV
MLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQ
RVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHA
HEKISKLLADDEQLQQHVKEIKEQLK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatattagacctgtggaaccaagcccttgctcaaatcgaaaaaaagttgagc
aaaccgagttttgagacttggatgaagtcaaccaaagcccactcactgcaaggcgataca
ttaacaatcacggctcccaatgaatttgccagagactggctggagtccagatacttgcat
ctgattgcagatactatatatgaattaaccggggaagaattgagcattaagtttgtcatt
cctcaaaatcaagatgttgaggactttatgccgaaaccgcaagtcaaaaaagcggtcaaa
gaagatacatctgattttcctcaaaatatgctcaatccaaaatatacttttgatactttt
gtcatcggatctggaaaccgatttgcacatgctgcttccctcgcagtagcggaagcgccc
gcgaaagcttacaaccctttatttatctatgggggcgtcggcttagggaaaacacactta
atgcatgcgatcggccattatgtaatagatcataatccttctgccaaagtggtttatctg
tcttctgagaaatttacaaacgaattcatcaactctatccgagataataaagccgtcgac
ttccgcaatcgctatcgaaatgttgatgtgcttttgatagatgatattcaatttttagcg
gggaaagaacaaacccaggaagaatttttccatacatttaacacattacacgaagaaagc
aaacaaatcgtcatttcaagtgaccggccgccaaaggaaattccgacacttgaagacaga
ttgcgctcacgttttgaatggggacttattacagatatcacaccgcctgatctagaaacg
agaattgcaattttaagaaaaaaggccaaagcagagggcctcgatattccgaacgaggtt
atgctttacatcgcgaatcaaatcgacagcaatattcgggaactcgaaggagcattaatc
agagttgtcgcttattcatctttaattaataaagatattaatgctgatctggccgctgag
gcgttgaaagatattattccttcctcaaaaccgaaagtcattacgataaaagaaattcag
agggtagtaggccagcaatttaatattaaactcgaggatttcaaagcaaaaaaacggaca
aagtcagtagcttttccgcgtcaaatcgccatgtacttatcaagggaaatgactgattcc
tctcttcctaaaatcggtgaagagtttggaggacgtgatcatacgaccgttattcatgcg
catgaaaaaatttcaaaactgctggcagatgatgaacagcttcagcagcatgtaaaagaa
attaaagaacagcttaaatag

DBGET integrated database retrieval system