KEGG   Bacillus subtilis subsp. subtilis 168: BSU00020Help
Entry
BSU00020          CDS       T00010                                 

Gene name
dnaN
Definition
(RefSeq) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03430  Mismatch repair
bsu03440  Homologous recombination
Module
bsu_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU00020 (dnaN)
   03430 Mismatch repair
    BSU00020 (dnaN)
   03440 Homologous recombination
    BSU00020 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU00020 (dnaN)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00020 (dnaN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU00020 (dnaN)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BSU00020 (dnaN)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BSU00020 (dnaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Motif
Other DBs
NCBI-GeneID: 939970
NCBI-ProteinID: NP_387883
Pasteur: BG10066
BSORF: BG10066
UniProt: P05649
Structure
PDB: 

Position
1939..3075
Genome map
AA seq 378 aa AA seqDB search
MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKE
EGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDA
DEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATD
SHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLF
FSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESI
EISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLI
RTPNDETIVQLILPVRTY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacgattcaaaaagatcgtcttgttgaaagtgtccaagatgtattaaaagca
gtttcatccagaaccacgattcccattctgactggtattaaaattgttgcatcagatgat
ggagtatcctttacagggagtgactcagatatttctattgaatccttcattccaaaagaa
gaaggagataaagaaatcgtcactattgaacagcccggaagcatcgttttacaggctcgc
ttttttagtgaaattgtaaaaaaattgccgatggcaactgtagaaattgaagtccaaaat
cagtatttgacgattatccgttctggtaaagctgaatttaatctaaacggactggatgct
gatgaatatccgcacttgccgcagattgaagagcatcatgcgattcagatcccaactgat
ttgttaaaaaatctaatcagacaaacagtatttgcagtgtccacctcagaaacacgccct
atcttgacaggtgtaaactggaaagtggagcaaagtgaattattatgcactgcaacggat
agccaccgtcttgcattaagaaaggcgaaacttgatattccagaagacagatcttataac
gtcgtgattccgggaaaaagtttaactgaactcagcaagattttagatgacaaccaggaa
cttgtagatatcgtcatcacagaaacccaagttctgtttaaagcgaaaaacgtcttgttc
ttctcacggcttctggacgggaattatccagacacaaccagcctgattccgcaagacagc
aaaacagaaatcattgtgaacacaaaagaattccttcaggccattgatcgtgcatctctt
ttagctagagagggacgcaacaacgttgtaaaactgtccgcaaaaccggctgaatccatt
gaaatttcttccaattcgccagaaatcggtaaagttgtggaagcaattgttgcggatcaa
attgaaggtgaggaattaaatatctcttttagtccaaaatatatgctggatgcactaaag
gtgcttgaaggagcagaaatacgcgtaagctttacaggcgcaatgagacctttcttaatt
cgcacgccgaatgatgaaacgattgtacagcttatccttcctgtcagaacctattaa

DBGET integrated database retrieval system