KEGG   Bacillus subtilis subsp. subtilis 168: BSU00040Help
Entry
BSU00040          CDS       T00010                                 

Gene name
recF
Definition
(RefSeq) DNA replication and repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU00040 (recF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00040 (recF)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU00040 (recF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_23 AAA_21 AAA_27 DUF2813 AAA_29 ABC_tran
Motif
Other DBs
NCBI-GeneID: 939454
NCBI-ProteinID: NP_387885
Pasteur: BG10068
BSORF: BG10068
UniProt: P05651
Position
3437..4549
Genome map
AA seq 370 aa AA seqDB search
MYIQNLELTSYRNYDHAELQFENKVNVIIGENAQGKTNLMEAIYVLSMAKSHRTSNDKEL
IRWDKDYAKIEGRVMKQNGAIPMQLVISKKGKKGKVNHIEQQKLSQYVGALNTIMFAPED
LNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHFLKQLQTRKQTDRTMLDV
LTDQLVEVAAKVVVKRLQFTAQLEKWAQPIHAGISRGLEELTLKYHTALDVSDPLDLSKI
GDSYQEAFSKLREKEIERGVTLSGPHRDDVLFYVNGRDVQTYGSQGQQRTTALSLKLAEI
DLIHEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQTFVTTTSVDGIDHETLRQAGM
FRVQNGALVK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgtatatccagaacttagaactgacatcttaccgcaactacgaccatgctgaacttcaa
tttgaaaataaagtaaatgtgatcatcggagaaaacgcccaggggaagacaaacctcatg
gaggcgatctatgtcttgtccatggcgaaatcgcaccggacatcaaatgacaaagaactt
atacggtgggacaaagactatgctaaaatagagggaagagtgatgaagcaaaacggggcg
atcccgatgcagctcgtcatctccaaaaagggtaaaaagggcaaggtcaatcatattgaa
cagcaaaagctcagccagtatgtcggggccctcaacaccattatgttcgcgccggaagat
ttaaatcttgtaaagggaagccctcaagtgagaaggcggtttcttgacatggaaatcgga
caggtttctcccgtctaccttcatgatctttctctttaccagaaaatcctttcccagcgg
aatcattttttgaaacagctgcaaacaagaaaacaaactgaccggacgatgctcgatgtt
ctgaccgatcagcttgtagaagttgcagcaaaagtcgtcgtaaaacgcctgcagtttaca
gcacagctcgagaaatgggcgcagcccatccatgcaggcatctcaagagggcttgaagaa
ctgaccctgaaataccatacagctcttgatgtatcagatcccctagatttgtcgaaaata
ggagatagctatcaagaagcgttttctaaattaagagaaaaagaaattgagcgtggtgtg
acgctgtcagggcctcatcgcgatgatgttcttttctatgtgaacggacgcgatgtgcag
acgtatggttctcaaggacagcagcgaacgacggcgttgtcccttaagctggcggagatt
gacctgatccatgaagaaatcggagaatatcccattttactattggatgatgtactgagt
gaactggatgattatcgccagtcacacttgcttcatacgatccaaggccgtgtacaaacg
tttgtcacaacgacaagcgttgatggcattgatcacgaaaccttacgtcaagcaggaatg
ttccgtgtgcaaaatggtgcgttagtgaagtga

DBGET integrated database retrieval system