KEGG   Bacillus subtilis subsp. subtilis 168: BSU00050Help
Entry
BSU00050          CDS       T00010                                 

Gene name
yaaB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF370
Motif
Other DBs
NCBI-GeneID: 939466
NCBI-ProteinID: NP_387886
Pasteur: BG10069
BSORF: BG10069
UniProt: P37525
Position
4567..4812
Genome map
AA seq 81 aa AA seqDB search
MYIHLGDDFVVSTRDIVGIFDFKANMSPIVEEFLKKQKHKVVPSVNGTPKSIVVTVQNIY
YSPLSSSTLKKRAQFMFEIDS
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
ttgtatattcatttaggtgatgactttgtggtttcaacacgagatattgtcggcattttt
gactttaaagccaacatgtcgcctattgttgaagaatttctgaaaaaacagaaacacaag
gtggtgccttccgtaaacggcacgcccaaatctatcgtagtcacggttcagaatatatat
tactctcccttatcttccagcacattaaaaaaacgtgcgcaatttatgtttgaaatagat
tcttag

DBGET integrated database retrieval system