KEGG   Bacillus subtilis subsp. subtilis 168: BSU00070Help
Entry
BSU00070          CDS       T00010                                 

Gene name
gyrA
Definition
(RefSeq) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU00070 (gyrA)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00070 (gyrA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     BSU00070 (gyrA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Topoisomerases
   BSU00070 (gyrA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BSU00070 (gyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C NTase_sub_bind Robl_LC7
Motif
Other DBs
NCBI-GeneID: 940002
NCBI-ProteinID: NP_387888
Pasteur: BG10071
BSORF: BG10071
UniProt: P05653
Structure
PDB: 

Position
6994..9459
Genome map
AA seq 821 aa AA seqDB search
MSEQNTPQVREINISQEMRTSFLDYAMSVIVSRALPDVRDGLKPVHRRILYAMNDLGMTS
DKPYKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFNYRYMLVDGHGNFGSVDGDSAAA
MRYTEARMSKISMEILRDITKDTIDYQDNYDGSEREPVVMPSRFPNLLVNGAAGIAVGMA
TNIPPHQLGEIIDGVLAVSENPDITIPELMEVIPGPDFPTAGQILGRSGIRKAYESGRGS
ITIRAKAEIEQTSSGKERIIVTELPYQVNKAKLIEKIADLVRDKKIEGITDLRDESDRTG
MRIVIEIRRDANANVILNNLYKQTALQTSFGINLLALVDGQPKVLTLKQCLEHYLDHQKV
VIRRRTAYELRKAEARAHILEGLRVALDHLDAVISLIRNSQTAEIARTGLIEQFSLTEKQ
AQAILDMRLQRLTGLEREKIEEEYQSLVKLIAELKDILANEYKVLEIIREELTEIKERFN
DERRTEIVTSGLETIEDEDLIERENIVVTLTHNGYVKRLPASTYRSQKRGGKGVQGMGTN
EDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPEYGRTAKGIPIINLLEVEKGEWINA
IIPVTEFNAELYLFFTTKHGVSKRTSLSQFANIRNNGLIALSLREDDELMGVRLTDGTKQ
IIIGTKNGLLIRFPETDVREMGRTAAGVKGITLTDDDVVVGMEILEEESHVLIVTEKGYG
KRTPAEEYRTQSRGGKGLKTAKITENNGQLVAVKATKGEEDLMIITASGVLIRMDINDIS
ITGRVTQGVRLIRMAEEEHVATVALVEKNEEDENEEEQEEV
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaaacacaccacaagttcgtgaaataaatatcagtcaggaaatgcgtacg
tccttcttggattatgcaatgagcgttatcgtgtcccgtgctcttccggatgttcgtgac
ggtttaaaaccggttcatagacggattttgtatgcaatgaatgatttaggcatgacaagt
gacaagccttataaaaaatccgcgcgtatcgttggagaagttatcgggaaataccacccg
cacggtgattcagcggtatatgaatccatggtcagaatggctcaggatttcaactaccgt
tatatgctcgttgacggtcacggaaacttcggttctgttgacggagactcagcggcggcc
atgcgttatacagaagcacgaatgtctaaaatctcaatggagattcttcgcgacatcaca
aaagacacaatcgattaccaggataactatgacgggtcagaaagagaacctgtcgttatg
ccttcaaggttcccgaatctgctcgtgaacggtgctgccggcattgcggtaggtatggca
acaaacattcctccgcaccagctgggagaaatcattgacggtgtacttgctgttagtgag
aatccggacattacaattccagagcttatggaagtcattccagggcctgatttcccgacc
gcgggtcaaatcttgggacgcagcggtatccggaaagcatacgaatcaggccgaggctct
atcacgatccgggcaaaagctgagatcgaacaaacatcttcgggtaaagaaagaattatc
gttacagagttaccttaccaagtaaataaggcgaaattaattgagaaaattgctgatctc
gtaagggacaaaaagatagagggtatcacagatctgcgtgatgagtcagatcgtacaggt
atgagaattgtcattgaaatcagacgcgatgccaatgcgaatgttatcttaaacaatctg
tacaaacaaactgctctacaaacatcttttggcatcaacctgcttgcgcttgttgatggc
cagccgaaagttttaactcttaagcaatgcctggagcattaccttgaccatcaaaaagtt
gtcattagacgccgtactgcttatgaattgcgtaaagcagaagcgagagctcatatcttg
gaaggattgagagttgcactggatcatctcgatgcagttatctcccttatccgtaattct
caaacggctgaaattgcgagaacaggtttaattgaacaattctcactgacagagaagcaa
gcacaagcgatccttgacatgaggctccagcgtttaacgggactggaacgtgaaaagatc
gaagaagaataccagtctcttgttaaattaattgcagagctaaaagacatcttggcaaat
gaatataaagtgcttgagatcattcgtgaagaactcacggaaatcaaagagcgttttaac
gatgaaagacgtactgagatcgtcacttctggactggagacaattgaagatgaagatctc
atcgagagagaaaatatcgtagttactctgacgcacaacggatacgtcaaacgtcttcct
gcatcaacttaccgcagtcaaaaacggggcggaaaaggtgtacaaggtatgggaacaaac
gaagatgatttcgttgaacatttgatctctacgtcaactcatgacacgattctcttcttc
tcgaacaaggggaaagtgtatcgtgcaaaagggtatgaaatccctgaatacggcagaacg
gcaaaaggaatcccgattattaacctgctggaggtagaaaagggtgagtggatcaacgcg
attattccagtcacggaattcaatgcggagctttacctcttcttcactacaaagcatggg
gtttcaaaacgaacatcgctatctcaattcgctaatatccgcaacaatggtctaattgct
ctgagtcttcgtgaagatgatgaactgatgggtgtacgtctgactgacggcacaaaacaa
atcatcattggaacgaaaaacggtttactgattcgtttccctgaaacagatgtccgagag
atgggaagaactgcggcgggcgtaaaaggcatcaccctgacggatgacgacgttgttgtc
ggcatggagattttagaggaagaatcacacgtccttatcgtaactgaaaaagggtacgga
aaacgaactcctgctgaagagtacagaacccaaagccggggcggaaaaggactcaaaaca
gcgaaaatcaccgagaacaacggccaactagtagcagtgaaagctactaaaggtgaagag
gatctaatgattattacagctagcggcgtactcatcagaatggacatcaatgatatctcc
atcaccggacgtgtcactcaaggtgtgcgtctcatcagaatggcagaagaagagcatgtt
gctacagtagctttagttgagaaaaacgaagaagatgagaatgaagaagaacaagaagaa
gtgtga

DBGET integrated database retrieval system