KEGG   Bacillus subtilis subsp. subtilis 168: BSU00090Help
Entry
BSU00090          CDS       T00010                                 

Gene name
guaB
Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU00090 (guaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU00090 (guaB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     BSU00090 (guaB)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSU00090 (guaB)
  Exosomal proteins of breast cancer cells
   BSU00090 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh DeoC NanE B12-binding
Motif
Other DBs
NCBI-GeneID: 938032
NCBI-ProteinID: NP_387890
Pasteur: BG10073
BSORF: BG10073
UniProt: P21879
Position
15915..17381
Genome map
AA seq 488 aa AA seqDB search
MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTKTLKLNIPVISAGMDTVTESAMA
IAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTPDHQVFDAEHLMGKYRI
SGVPIVNNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELVTASVGTTLDEAEKILQK
HKIEKLPLVDDQNKLKGLITIKDIEKVIEFPNSSKDIHGRLIVGAAVGVTGDTMTRVKKL
VEANVDVIVIDTAHGHSQGVLNTVTKIRETYPELNIIAGNVATAEATRALIEAGADVVKV
GIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKTIIADGGIKFSGDITKALAAGGHA
VMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEKGSKDRYFQEENKKFVPEGIEG
RTPYKGPVEETVYQLVGGLRSGMGYCGSKDLRALREEAQFIRMTGAGLRESHPHDVQITK
ESPNYTIS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaagtaaattttcaaaagaaggcttaacgttcgacgatgtgctgcttgtacca
gcaaagtctgaggtacttccgcgtgatgtggatttatctgtagaacttacaaaaacgtta
aagctaaatattcctgtcatcagcgcaggtatggacactgtaacagaatcagcaatggca
attgcaatggcaagacagggcggcttgggcatcattcacaaaaatatgtccattgaacag
caggctgaacaagttgataaagtaaagcgttctgagcgcggcgttatcacaaatcccttc
tttttaactcctgatcaccaagtatttgatgcggagcatttgatggggaaatacagaatt
tccggtgttccgattgtaaataacgaagaagaccagaagcttgttggaattattacaaac
cgtgaccttcgttttatttctgactactcaatgaaaatcagcgacgtcatgacgaaagaa
gagctagttactgcatctgtaggaactactctggatgaagctgaaaagattttgcagaaa
cataaaattgaaaagcttcctctcgtagatgaccagaataaattaaaaggtcttatcaca
attaaagacattgaaaaagtcattgagttcccgaactcatctaaagacattcacggccgc
ctgatcgttggcgcggcagttggtgtaactggcgatacaatgactcgcgtcaaaaagctt
gttgaagccaatgttgatgtgattgttatcgatacagctcacggacactctcaaggcgtt
ttaaacacagtcacaaaaatccgtgaaacgtatcccgaattaaacattattgctggaaac
gtggcaacagctgaagcgacaagagcgcttatcgaagctggagcagacgttgtcaaagtt
ggaatagggcctggttcaatttgtactacacgtgttgtagccggcgtgggtgttccgcaa
attacagcaatttatgattgtgcgactgaagcaagaaaacacggcaaaacaatcatcgcc
gacggtgggattaaattctctggcgatatcactaaagcattggcagccggcggacatgct
gttatgctcggaagcttgcttgcaggcacatcagaaagccctggtgaaactgaaatctac
caaggcagaagatttaaggtataccgcggcatgggatcagttgctgcaatggaaaaagga
agtaaagaccgttacttccaagaagaaaacaaaaaatttgttcctgaaggaattgaagga
cgcacaccttacaaagggccagttgaagaaaccgtttatcagctagtcggaggccttcgt
tctggtatggggtattgcgggtccaaagatctgcgtgcgctaagagaagaagctcagttc
attcgcatgactggcgcaggacttcgcgaaagccatccgcatgacgtacagattacaaaa
gaatcacctaactatacaatttcataa

DBGET integrated database retrieval system