KEGG   Bacillus subtilis subsp. subtilis 168: BSU00100Help
Entry
BSU00100          CDS       T00010                                 

Gene name
dacA
Definition
(RefSeq) D-alanyl-D-alanine carboxypeptidase DacA
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU00100 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU00100 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU00100 (dacA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSU00100 (dacA)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BSU00100 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BSU00100 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase LTD
Motif
Other DBs
NCBI-GeneID: 940000
NCBI-ProteinID: NP_387891
Pasteur: BG10074
BSORF: BG10074
UniProt: P08750
Position
17534..18865
Genome map
AA seq 443 aa AA seqDB search
MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIMIEASSGKILYSKNAD
KRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQDNSLSNVPLRKDGKYTV
KELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGLTDYKFVNATGLENKDLH
GHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAKTKFREGTDDEMDMPNWNF
MLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAERNGMRVITVVLNAKGNLHTGRFDETK
KMFDYAFDNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGIVTNKAFSLPVKNGEEKNYKA
KVTLNKDNLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSDLAGVDLVTKENVEKANWFVLT
MRSIGGFFAGIWGSIVDTVTGWF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatcaagaaatgtaaacagctactgatgtcattggttgtgttaactctagctgtc
acgtgtctggctccaatgtcaaaagcgaaagcagccagcgatccaattgatatcaatgca
tctgctgctattatgatcgaagcttcttcaggtaaaattctttacagtaaaaatgcagat
aagagactgccaattgcgagtatgacaaaaatgatgacagagtatctgttattggaagca
attgatcaaggtaaagtgaaatgggaccaaacctatacgcctgatgactatgtgtatgaa
atttcccaagataacagcttatcaaacgttcctcttcggaaagacgggaaatacacagta
aaagaattatatcaagctacagcaatttattctgcaaatgctgctgctattgcgattgca
gaaatcgttgccggttctgaaactaagtttgttgaaaaaatgaatgcaaaagcaaaagaa
ctaggcttaacagattacaaatttgttaacgcaacaggtcttgaaaacaaagatcttcac
gggcatcagcctgaggggacaagcgtaaatgaagaaagtgaagtttctgcaaaggatatg
gcggttcttgcggatcacttgattactgactaccctgagatactggagacttccagtatc
gccaaaacgaaattcagagaaggcaccgatgatgaaatggacatgccgaactggaatttt
atgctgaaggggcttgtcagcgagtataaaaaagcgactgtagacggactgaaaacaggt
tctactgactctgcgggttcatgctttacaggaacagctgaacgcaacggtatgcgtgtc
atcactgttgttttaaacgcaaagggcaaccttcatacaggccgtttcgatgaaacgaaa
aaaatgtttgattatgctttcgacaatttctccatgaaagaaatttatgctgaaggcgat
caagtaaaaggccataaaacaatttcagttgataagggtaaagagaaagaagtaggcatt
gtgacaaacaaggcgttctctcttcctgtcaaaaatggtgaagaaaagaattacaaagcg
aaggtcacactgaataaagacaacttaactgctcctgtgaaaaaaggaaccaaggttggg
aagctgactgcggaatacacaggtgatgaaaaggattacggattccttaacagcgatctg
gctggcgtagaccttgttacaaaagaaaatgtagaaaaagcaaactggtttgttttgaca
atgcgcagtatcggcggattttttgccggaatttggggaagcattgttgatacggtaacc
ggctggttttaa

DBGET integrated database retrieval system