KEGG   Bacillus subtilis subsp. subtilis 168: BSU00110Help
Entry
BSU00110          CDS       T00010                                 

Gene name
yaaD
Definition
(RefSeq) pyridoxal biosynthesis lyase PdxS
  KO
K06215  pyridoxal 5'-phosphate synthase pdxS subunit [EC:4.3.3.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00750  Vitamin B6 metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSU00110 (yaaD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     BSU00110 (yaaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SOR_SNZ ThiG Dus NanE OMPdecase NMO TetR_C_27 His_biosynth IGPS IMPDH
Motif
Other DBs
NCBI-GeneID: 939988
NCBI-ProteinID: NP_387892
Pasteur: BG10075
BSORF: BG10075
UniProt: P37527 Q2Y2R1
Structure
PDB: 

Position
19062..19946
Genome map
AA seq 294 aa AA seqDB search
MAQTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMALERVPADIRAAGGVAR
MADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEAMGVDYIDESEVLTPADEEFHLNKNE
YTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRHMRKVNAQVRKVVAMSED
ELMTEAKNLGAPYELLLQIKKDGKLPVVNFAAGGVATPADAALMMQLGADGVFVGSGIFK
SDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEISNLLPEQRMQERGW
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaacaggtactgaacgtgtaaaacgcggaatggcagaaatgcaaaaaggcggc
gtcatcatggacgtcatcaatgcggaacaagcgaaaatcgctgaagaagctggagctgtc
gctgtaatggcgctagaacgtgtgccagcagatattcgcgcggctggaggagttgcccgt
atggctgaccctacaatcgtggaagaagtaatgaatgcagtatctatcccggtaatggca
aaagcgcgtatcggacatattgttgaagcgcgtgtgcttgaagctatgggtgttgactat
attgatgaaagtgaagttctgacgccggctgacgaagaatttcatttaaataaaaatgaa
tacacagttccttttgtctgtggctgccgtgatcttggtgaagcaacacgccgtattgcg
gaaggtgcttctatgcttcgcacaaaaggtgagcctggaacaggtaatattgttgaggct
gttcgccatatgcgtaaagttaacgctcaagtgcgcaaagtagttgcgatgagtgaggat
gagctaatgacagaagcgaaaaacctaggtgctccttacgagcttcttcttcaaattaaa
aaagacggcaagcttcctgtcgttaactttgccgctggcggcgtagcaactccagctgat
gctgctctcatgatgcagcttggtgctgacggagtatttgttggttctggtatttttaaa
tcagacaaccctgctaaatttgcgaaagcaattgtggaagcaacaactcactttactgat
tacaaattaatcgctgagttgtcaaaagagcttggtactgcaatgaaagggattgaaatc
tcaaacttacttccagaacagcgtatgcaagaacgcggctggtaa

DBGET integrated database retrieval system