KEGG   Bacillus subtilis subsp. subtilis 168: BSU00120Help
Entry
BSU00120          CDS       T00010                                 

Gene name
yaaE
Definition
(RefSeq) glutamine amidotransferase subunit PdxT
  KO
K08681  5'-phosphate synthase pdxT subunit [EC:4.3.3.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00750  Vitamin B6 metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSU00120 (yaaE)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     BSU00120 (yaaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNO GATase_3 GATase Peptidase_S51 DJ-1_PfpI Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 939971
NCBI-ProteinID: NP_387893
Pasteur: BG10076
BSORF: BG10076
UniProt: P37528
Structure
PDB: 

Position
19968..20558
Genome map
AA seq 196 aa AA seqDB search
MLTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEVDGLILPGGESTTMRRLIDTYQ
FMEPLREFAAQGKPMFGTCAGLIILAKEIAGSDNPHLGLLNVVVERNSFGRQVDSFEADL
TIKGLDEPFTGVFIRAPHILEAGENVEVLSEHNGRIVAAKQGQFLGCSFHPELTEDHRVT
QLFVEMVEEYKQKALV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaataggtgtactaggacttcaaggagcagttagagagcacatccatgcgatt
gaagcatgcggcgcggctggtcttgtcgtaaaacgtccggagcagctgaacgaagttgac
gggttgattttgccgggcggtgagagcacgacgatgcgccgtttgatcgatacgtatcaa
ttcatggagccgcttcgtgaattcgctgctcagggcaaaccgatgtttggaacatgtgcc
ggattaattatattagcaaaagaaattgccggttcagataatcctcatttaggtcttctg
aatgtggttgtagaacgtaattcatttggccggcaggttgacagctttgaagctgattta
acaattaaaggcttggacgagccttttactggggtattcatccgtgctccgcatatttta
gaagctggtgaaaatgttgaagttctatcggagcataatggtcgtattgtagccgcgaaa
caggggcaattccttggctgctcattccatccggagctgacagaagatcaccgagtgacg
cagctgtttgttgaaatggttgaggaatataagcaaaaggcacttgtataa

DBGET integrated database retrieval system