KEGG   Bacillus subtilis subsp. subtilis 168: BSU00130Help
Entry
BSU00130          CDS       T00010                                 

Gene name
serS
Definition
(RefSeq) serine--tRNA ligase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Module
bsu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU00130 (serS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU00130 (serS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU00130 (serS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     BSU00130 (serS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BSU00130 (serS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU00130 (serS)
 Prokaryotic Type
    BSU00130 (serS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N ZapB UvrD_C FapA FlgN NPV_P10 PCRF DUF1664 Borrelia_P83 DHR10 GAS
Motif
Other DBs
NCBI-GeneID: 939994
NCBI-ProteinID: NP_387894
Pasteur: BG10077
BSORF: BG10077
UniProt: P37464
Position
20880..22157
Genome map
AA seq 425 aa AA seqDB search
MLDTKMLRANFQEIKAKLVHKGEDLTDFDKFEALDDRRRELIGKVEELKGKRNEVSQQVA
VLKREKKDADHIIKEMREVGEEIKKLDEELRTVEAELDTILLSIPNIPHESVPVGETEDD
NVEVRKWGEKPSFAYEPKPHWDIADELGILDFERAAKVTGSRFVFYKGLGARLERALYNF
MLDLHVDEYNYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIREEDYFLIPTAEVPITNMH
RDEILSGDSLPINYAAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEELE
KLTNQAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSQDTYREISSCSNFEAFQ
ARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAAILENYQQEDGSVVIPKVLRPYMGNR
EVMKP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatacgaaaatgctgagagcaaattttcaagaaattaaagcaaagcttgtacac
aaaggcgaagacttaactgattttgataagtttgaggcgctggatgatagacgaagagag
cttatcggcaaggttgaagagttaaaaggaaaacgaaatgaagtttctcagcaggttgct
gtgctgaagcgtgagaaaaaagacgcggatcacattattaaagaaatgcgtgaagtcggc
gaggaaattaaaaagctcgatgaagaattacggacagtggaagctgagcttgatacaatc
ctgctctcaatcccgaatattccgcatgagtctgtacctgtcggtgaaacagaagacgac
aacgtagaagtgcgtaaatggggtgaaaagccttcatttgcttatgagccgaagccgcac
tgggatattgcggatgagctgggtattctggattttgaacgtgctgccaaagtaacagga
agccgtttcgtgttctataaaggcttaggtgctcgtctggagcgtgcgctttataacttt
atgcttgatctgcatgtggatgagtataactacactgaagtgatcccgccatatatggta
aaccgcgcaagcatgacgggaacggggcagcttcctaaatttgaagaggatgcatttaaa
atcagagaagaagattatttcttaattccaacggcggaagtgccgattacaaacatgcat
cgcgatgaaatcctttcaggtgacagcctgccgatcaactatgcggcattcagtgcttgc
ttccgttctgaagctggttcagcaggacgtgacacacgcggattaattcgtcagcaccaa
tttaataaagttgagcttgtaaagtttgtgaagcctgaagattcttatgaagaattagag
aaacttacaaaccaagcagaacgggttcttcagctgcttgagcttccataccgtgtcatg
agcatgtgtacgggtgacttaggctttacggctgcgaaaaaatacgatatcgaagtttgg
attccaagccaagacacatatcgagaaatctcttcttgcagcaacttcgaagcgttccag
gcgagacgtgcgaatattcgtttcagacgtgaagcgaaaggcaagcctgagcatgtacac
acactgaacggctcaggactggcggttggaagaacagttgctgctatcttagaaaattat
cagcaggaagacggaagcgttgtgattccgaaagtgcttcgtccttatatggggaataga
gaagtaatgaaaccgtaa

DBGET integrated database retrieval system