KEGG   Bacillus subtilis subsp. subtilis 168: BSU00140Help
Entry
BSU00140          CDS       T00010                                 

Gene name
dck
Definition
(RefSeq) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU00140 (dck)
   00240 Pyrimidine metabolism
    BSU00140 (dck)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BSU00140 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BSU00140 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 SKI AAA_33 TsaE ABC_tran AAA_17 Cytidylate_kin2 AAA_22 RsgA_GTPase Cytidylate_kin RNA_helicase AAA_16 PRK AAA_25 Rad17 AAA_14 AAA MMR_HSR1 ParA GTP_EFTU AAA_5 HTH_6
Motif
Other DBs
NCBI-GeneID: 936793
NCBI-ProteinID: NP_387895
Pasteur: BG10078
BSORF: BG10078
UniProt: P37529
Position
complement(22496..23149)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSYWEEMHTRYENWISGFNA
CPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacatcatatccctaagaattcaattattacagtagcaggaacagtaggtgtc
ggaaaatcgactttaacaaaaactttagctaaacggcttggatttaaaacatcgttggag
gaagtcgatcataatccatatttggaaaagttctatcatgattttgaacgttggagcttt
caccttcaaatttacttcttagctgaacgcttcaaagaacagaaaacaatttttgaagcc
ggcggaggttttgtacaggatcgttcgatttatgaagatacaggaattttcgcaaaaatg
catgctgataaagggacaatgtcaaaggttgattataagacttacacaagccttttcgaa
gcaatggtaatgacaccgtatttcccacatccagatgtgttgatctatttagaaggagat
ctggagaacattttaaaccggattgaacaacgcggccgtgagatggagcttcagacaagc
cggtcttattgggaagaaatgcatacacgctacgagaactggataagcggttttaatgcc
tgccctgttttaaaacttcgcattgaagattatgatcttctgaacgacgaaaactcgatt
gaaaatattgtagatcaaattgcttcagttattcatgataatcaaaaaaagtga

DBGET integrated database retrieval system