KEGG   Bacillus subtilis subsp. subtilis 168: BSU00150Help
Entry
BSU00150          CDS       T00010                                 

Gene name
dgk
Definition
(RefSeq) deoxyguanosine kinase
  KO
K15518  deoxyguanosine kinase [EC:2.7.1.113]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU00150 (dgk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.113  deoxyguanosine kinase
     BSU00150 (dgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_33 AAA_28 AAA_17 SKI Cytidylate_kin TsaE Cytidylate_kin2 AAA_22 AAA ABC_tran CoaE RuvB_N PRK cobW AAA_16 AAA_23
Motif
Other DBs
NCBI-GeneID: 937037
NCBI-ProteinID: NP_387896
Pasteur: BG10079
BSORF: BG10079
UniProt: P37530
Position
complement(23146..23769)
Genome map
AA seq 207 aa AA seqDB search
MNTAPFIAIEGPIGAGKTTLATMLSQKFGFPMINEIVEDNPYLDKFYDNIKEWSFQLEMF
FLCHRYKQLEDTSDHFLKKGQPVIADYHIYKNVIFAERTLSPHQLEKYKKIYHLLTDDLP
KPNFIIYIKASLPTLLHRIEKRGRPFEKKIETSYLEQLISDYEVAIKQLQEADPELTVLT
VDGDSKDFVLNKSDFERIAAHVKELIV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagccccttttattgcaatagaaggtcctatcggggcaggaaaaacaactctc
gcaacgatgctctcacaaaaattcggattccctatgatcaatgagattgtagaggataac
ccgtaccttgataagttttatgacaatataaaggaatggagcttccagctcgagatgttt
tttctttgtcacagatacaaacagcttgaagacaccagtgatcactttttaaaaaaggga
cagcctgtaatagctgattatcatatttataaaaatgtgatttttgcggaacgaaccttg
tctccacatcagctggaaaaatacaaaaagatatatcacctgctaacggatgatctgcca
aagccgaatttcatcatttacataaaggccagtctgcctacattgctacaccgcattgaa
aaacgcgggcgcccctttgagaaaaaaattgaaactagctatttggagcagctgatttca
gattatgaagtcgccatcaagcagctgcaggaagcagaccctgaacttacagtgttaacc
gtagatggtgattcaaaggatttcgttttgaataagagcgactttgaacgcattgccgcc
catgtaaaggagcttatcgtatga

DBGET integrated database retrieval system