KEGG   Bacillus subtilis subsp. subtilis 168: BSU00160Help
Entry
BSU00160          CDS       T00010                                 

Gene name
yaaH
Definition
(RefSeq) spore germination protein YaaH
  KO
K06306  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU00160 (yaaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 LysM GyrB_insert
Motif
Other DBs
NCBI-GeneID: 937029
NCBI-ProteinID: NP_387897
Pasteur: BG10080
BSORF: BG10080
UniProt: P37531
Position
complement(23868..25151)
Genome map
AA seq 427 aa AA seqDB search
MVKQGDTLSAIASQYRTTTNDITETNEIPNPDSLVVGQTIVIPIAGQFYDVKRGDTLTSI
ARQFNTTAAELARVNRIQLNTVLQIGFRLYIPPAPKRDIESNAYLEPRGNQVSENLQQAA
REASPYLTYLGAFSFQAQRNGTLVAPPLTNLRSITESQNTTLMMIITNLENQAFSDELGR
ILLNDETVKRRLLNEIVENARRYGFRDIHFDFEYLRPQDREAYNQFLREARDLFHREGLE
ISTALAPKTSATQQGRWYEAHDYRAHGEIVDFVVLMTYEWGYSGGPPQAVSPIGPVRDVI
EYALTEMPANKIVMGQNLYGYDWTLPYTAGGTPARAVSPQQAIVIADQNNASIQYDQTAQ
APFFRYTDAENRRHEVWFEDARSIQAKFNLIKELNLRGISYWKLGLSFPQNWLLLSDQFN
VVKKTFR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaacaaggcgacactctttctgctatcgcttcacaatacagaacaaccacaaat
gacatcactgaaacgaatgaaataccgaatcccgacagccttgttgtcggacaaaccatt
gtcattccaatagctggccagttctatgatgtgaagcgaggtgataccctgacatccatc
gcccggcagttcaatacaacagcagccgagctcgcaagggttaaccgcatccagttaaat
accgtgcttcagattggtttccgtttatacatccctccagctcctaaacgagacatcgaa
tcaaatgcttatttggagccccgaggaaatcaagtcagcgaaaatctccagcaggcggcc
agagaagcgtcgccctacttaacttaccttggcgcattcagcttccaggcacagcggaac
ggaaccttagtcgcaccgcctttaacgaatttaaggagcattacagaaagtcaaaataca
acattgatgatgattataacgaacctagaaaaccaggcattcagcgatgaacttggccgg
atccttttgaacgacgaaactgtaaaaagacggcttctaaatgaaatagtcgagaatgcc
agaagatatggcttccgtgacattcatttcgactttgaatatttgcggccccaggataga
gaggcctataatcaattcctccgcgaagcaagggatcttttccatcgagagggcttagaa
atttctacggctcttgctcctaaaacaagtgcaacacagcagggcaggtggtatgaagct
catgattacagggcacatggcgaaattgtcgactttgttgttctcatgacatatgaatgg
ggctatagcggcggaccgcctcaagcggtttctccaattggacctgtccgtgatgtcata
gaatatgctttgactgaaatgcctgcgaacaaaattgtcatgggccagaatttatatgga
tatgactggacgctgccatatacagcagggggaactccagcaagagcagtaagccctcag
caagccattgtcatagctgatcagaacaatgcttccattcagtatgaccaaaccgctcaa
gctcctttcttccgctatactgatgcagaaaacagaaggcacgaggtatggttcgaggat
gcccgctcgattcaagcaaaattcaatctgattaaagagctgaatttaagaggcatcagc
tattggaagctgggtctttcctttccacaaaactggctgctgctgtctgatcaatttaat
gttgtcaaaaagacgtttcgataa

DBGET integrated database retrieval system