KEGG   Bacillus subtilis subsp. subtilis 168: BSU00170Help
Entry
BSU00170          CDS       T00010                                 

Gene name
yaaI
Definition
(RefSeq) isochorismatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 937036
NCBI-ProteinID: NP_387898
Pasteur: BG10081
BSORF: BG10081
UniProt: P37532
Position
complement(25221..25766)
Genome map
AA seq 181 aa AA seqDB search
MSKADKALLIVDMINNFEFDMGETLAKKTEKIVPHILSLKEHARQNEWPIIYINDHYGLW
QADIKNIQQECTNERSKDIITKIAPVDADYFLIKPKHSAFYETALHTLLTELQVRHIIIT
GIAGNICVLFTANDAYMREYSITIPKDCIASNSDEDNEFALTMMENVLFAEITTEEQIIE
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaaagcagataaagcccttctcattgtagacatgatcaataattttgaattcgat
atgggggaaaccctcgctaaaaaaacagaaaaaatcgttcctcatattttatcattaaag
gagcacgcgagacaaaatgaatggccgattatttacatcaatgatcattatggactttgg
caagctgacattaaaaacatacagcaagaatgcacaaatgaaagaagcaaggatatcatc
acaaagatagctccggtagatgctgattattttttaatcaaaccgaaacattccgctttc
tacgaaacagcacttcacacccttcttactgagttgcaggtgagacatattatcataaca
ggtatagccggcaatatatgcgtgctgtttaccgctaatgacgcttatatgagggaatac
agcatcacgattcctaaggactgtatcgcgtcaaacagtgacgaagataacgaattcgcc
ttaaccatgatggagaatgttcttttcgcagaaattacgacggaagaacaaattatagaa
aaataa

DBGET integrated database retrieval system