KEGG   Bacillus subtilis subsp. subtilis 168: BSU00180Help
Entry
BSU00180          CDS       T00010                                 

Gene name
tadA
Definition
(RefSeq) tRNA-specific adenosine deaminase
  KO
K11991  tRNA(adenine34) deaminase [EC:3.5.4.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU00180 (tadA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.33  tRNA(adenine34) deaminase
     BSU00180 (tadA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Deaminases
    BSU00180 (tadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MafB19-deam dCMP_cyt_deam_1 Bd3614-deam SNAD4 APOBEC2 NAD2 APOBEC3 APOBEC_N Lar_restr_allev NAD1 APOBEC4_like DUF2162
Motif
Other DBs
NCBI-GeneID: 937989
NCBI-ProteinID: NP_387899
Pasteur: BG10082
BSORF: BG10082
UniProt: P21335
Position
25852..26337
Genome map
AA seq 161 aa AA seqDB search
MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRETEQRSIAHAEMLVID
EACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFDPKGGCSGTLMNLLQEE
RFNHQAEVVSGVLEEECGGMLSAFFRELRKKKKAARKNLSE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagatgaactttatatgaaagaagcaattaaagaagcgaaaaaggctgaagag
aaaggtgaagtgccaataggtgcggtgcttgtcattaatggtgaaattatagcgcgtgcg
cataatttaagagagactgaacagcgatctattgcccatgcagaaatgcttgtaattgat
gaagcgtgtaaggcactcggaacatggcggctggaaggtgcgactctttatgtgacgctt
gagccttgtccaatgtgtgctggtgcagtcgtactttctcgagtggaaaaagtggttttt
ggcgcatttgatccgaaaggcggctgttcaggcacgctaatgaaccttcttcaggaggaa
cgctttaatcatcaggctgaagtggtgagcggtgtgcttgaggaagaatgcggcggaatg
ctcagtgcgtttttcagagaactaagaaaaaagaagaaagccgccaggaaaaacttgtct
gaatag

DBGET integrated database retrieval system