KEGG   Bacillus subtilis subsp. subtilis 168: BSU00190Help
Entry
BSU00190          CDS       T00010                                 

Gene name
dnaX
Definition
(RefSeq) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03430  Mismatch repair
bsu03440  Homologous recombination
Module
bsu_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU00190 (dnaX)
   03430 Mismatch repair
    BSU00190 (dnaX)
   03440 Homologous recombination
    BSU00190 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU00190 (dnaX)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00190 (dnaX)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU00190 (dnaX)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BSU00190 (dnaX)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BSU00190 (dnaX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA RuvB_N TIP49 AAA_30 AAA_16 AAA_5 AAA_22 PIF1 AAA_assoc_2 Rad17 AAA_24 Mg_chelatase AAA_7 NPV_P10 DUF815 TsaE AAA_14 LPP
Motif
Other DBs
NCBI-GeneID: 936899
NCBI-ProteinID: NP_387900
Pasteur: BG10083
BSORF: BG10083
UniProt: P09122
Position
26814..28505
Genome map
AA seq 563 aa AA seqDB search
MSYQALYRVFRPQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSGPRGTGKTSAAKIFAK
AVNCEHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEIRDIRDKVKFAPSAVTY
KVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIPLTIISRCQRFDFKRITS
QAIVGRMNKIVDAEQLQVEEGSLEIIASAADGGMRDALSLLDQAISFSGDILKVEDALLI
TGAVSQLYIGKLAKSLHDKNVSDALETLNELLQQGKDPAKLIEDMIFYFRDMLLYKTAPG
LEGVLEKVKVDETFRELSEQIPAQALYEMIDILNKSHQEMKWTNHPRIFFEVAVVKICQT
SHQSAADLPEVDMLMKKIQQLEQEVERLKTTGIKAAAESPKKEAPRVPKGGKSNYKAPVG
RIHEILKEATRPDLDLLRNSWGKLLAHLKQQNKVSHAALLNDSEPVAAGSAAFVLKFKYE
IHCKMVAEDNNGVRTNLEQILESMLGKRMDLIGVPEAQWGKIREEFLEDHQQENEGSNEP
AEEDPLIAEAKKLVGADLIEIKD
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtgagttaccaagctttatatcgagtattcaggcctcagcgctttgaagatgtggtcgga
caagaacacattacaaaaacgctgcaaaatgcccttttgcaaaaaaagttttctcacgcc
tatctgttttccgggcctagaggaaccggaaaaaccagtgcagccaaaatatttgctaag
gctgtcaactgtgaacatgctcctgttgatgagccatgcaacgaatgtgcggcctgtaaa
gggataacaaacgggtcaatatccgatgtcatagaaattgacgccgcttctaataacggt
gttgatgagattcgtgacattcgcgataaagtgaagtttgccccatcggccgtcacatat
aaggtatatatcatagatgaggtgcatatgctttctatcggcgcttttaatgcattacta
aaaacattagaagagccgcctgagcattgtattttcatattagcaacaactgaaccgcac
aaaattcctttaaccattatctctagatgtcagcgttttgactttaaacgaattacctcc
caagcgattgtaggccgcatgaataaaattgttgatgctgaacagctgcaagtggaggaa
ggatcgctggaaatcatcgcgagtgctgcagacggagggatgagggatgccctgagcctt
cttgatcaggccatatcattcagcggcgatatcctgaaagtcgaagatgcgcttttaatt
acgggtgctgtttctcaattatatatcgggaagcttgcaaaatccctgcatgataaaaac
gtttctgacgcactggaaacattaaatgaattgcttcagcaaggaaaagatccagctaag
ctgatagaagatatgattttctatttcagggacatgctgctgtacaaaacagcccctggc
ttagagggagtgcttgagaaagtaaaagtcgatgaaacgttccgggaactaagtgaacaa
attccggctcaggccctatatgaaatgattgatattctgaacaagagccatcaggaaatg
aaatggacaaatcatccgcgtatctttttcgaagtggccgttgtgaagatttgccaaacc
tcacatcaatctgctgctgatctcccggaagtggatatgctgatgaaaaaaatccagcag
ctcgaacaggaagtagagcggctcaaaacaacgggcataaaagcagctgcggaaagcccg
aaaaaagaagcgccgcgtgtgccaaagggcgggaaatccaattacaaagcgccagtaggc
agaattcatgagattttgaaggaagccacaagaccggatcttgatctgctcagaaacagt
tggggcaagcttcttgctcatctcaaacagcaaaacaaagtatcacatgccgctttgctg
aatgacagtgaacctgtggctgccggatcggcggcatttgttctgaaattcaaatatgaa
attcattgtaaaatggtcgctgaggataacaacggagtccggactaatcttgagcagatt
ttagaatcgatgctcggaaaaagaatggatttgattggcgttccagaagcacaatggggt
aaaataagagaagaatttttagaagatcatcagcaggaaaatgaaggatcaaatgaaccg
gctgaagaagacccgcttattgccgaagcgaaaaagcttgttggagcggatttaattgaa
ataaaagactaa

DBGET integrated database retrieval system