KEGG   Bacillus subtilis subsp. subtilis 168: BSU00200Help
Entry
BSU00200          CDS       T00010                                 

Gene name
yaaK
Definition
(RefSeq) nucleoid-associated protein YaaK
  KO
K09747  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU00200 (yaaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbaB_DNA_bd ATP-grasp_4 Bac_DNA_binding DUF3602
Motif
Other DBs
NCBI-GeneID: 937027
NCBI-ProteinID: NP_387901
Pasteur: BG10084
BSORF: BG10084
UniProt: P24281
Position
28529..28852
Genome map
AA seq 107 aa AA seqDB search
MRGGMGNMQKMMKQMQKMQKDMAKAQEELAEKVVEGTAGGGMVTVKANGQKEILDVIIKE
EVVDPEDIDMLQDLVLAATNEALKKVDEITNETMGQFTKGMNMPGLF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcggaatgggtaatatgcaaaaaatgatgaaacaaatgcaaaaaatgcaaaag
gacatggcgaaggctcaagaagagcttgcagaaaaggttgttgaaggaactgcaggcggc
ggtatggtaacagtaaaagcaaacggccaaaaagaaatcctggatgttatcatcaaagaa
gaagtcgttgatcctgaagatattgatatgcttcaagatttagtgcttgctgcaacgaat
gaagctttgaaaaaagttgacgaaatcacaaacgaaacaatgggtcaatttacaaaggga
atgaacatgccaggtttattctag

DBGET integrated database retrieval system