KEGG   Bacillus subtilis subsp. subtilis 168: BSU00210Help
Entry
BSU00210          CDS       T00010                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU00210 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00210 (recR)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU00210 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU00210 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 Zn_ribbon_17 PI3_PI4_kinase
Motif
Other DBs
NCBI-GeneID: 937197
NCBI-ProteinID: NP_387902
Pasteur: BG10085
BSORF: BG10085
UniProt: P24277
Position
28867..29463
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtagta
ttagattttgcgaaagcattagtaaatgcgaaacgcaacctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacgcgcagggataagtct
gttatctgtgttgtgcaagaccctaaagacgttatcgctatggagaaaatgaaggaatac
aacggacagtatcacgttcttcacggcgctatttctccaatggacggcatcggaccggag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatc
ctcgcgacaaaccctaatatagaaggggaagcaacagcgatgtatatatcaaggctcctc
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system