KEGG   Bacillus subtilis subsp. subtilis 168: BSU00220Help
Entry
BSU00220          CDS       T00010                                 

Gene name
yaaL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2508 DUF1043 DUF4638 Ly49
Motif
Other DBs
NCBI-GeneID: 937026
NCBI-ProteinID: NP_387903
Pasteur: BG10086
BSORF: BG10086
UniProt: P37533
Position
29481..29705
Genome map
AA seq 74 aa AA seqDB search
MGFLRKKTLRREFDEKLTEQLFKQKEEWNRQKKLVEKSLEPSAEVLYELKVAEAKYFFYL
REAKQRNLKISRWK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttcgcaagaaaacattaagaagagagtttgatgaaaaactaaccgagcag
ctttttaagcaaaaggaagagtggaacaggcaaaaaaagctggttgaaaaaagcttagaa
ccgtctgctgaagtgttatacgaactgaaagtagctgaagcgaagtattttttttactta
agggaagcgaagcagcgaaatttaaaaatcagccggtggaagtaa

DBGET integrated database retrieval system